SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005597 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005597
Domain Number 1 Region: 226-371
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.88e-36
Family Asparaginyl hydroxylase-like 0.068
Further Details:      
 
Domain Number 2 Region: 1080-1312
Classification Level Classification E-value
Superfamily RNI-like 6.28e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.022
Further Details:      
 
Domain Number 3 Region: 653-731
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000427
Family PHD domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005597   Gene: ENSEEUG00000006069   Transcript: ENSEEUT00000006132
Sequence length 1335
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8957:60202:230901:-1 gene:ENSEEUG00000006069 transcript:ENSEEUT00000006132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAGLWESGEDQYPSPQQKRHAAEKKKKIINTKCFEFRSFTXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNYEYVQREALRVPLVFREKDGLGIKMPDPD
FTVRDVKLLVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYCLMSVKGCFTDFH
IDFGGTSVWYHVFRGGKIFWLIPPTLHNLALYEEWVLSGKQSDIFLGDRVERCQRIELKQ
GYTFFIPSGWIHAVYTPVDSLVFGGNILHSFNVPMQLRIYEIEDRTRVQPKFRYPFYYEM
CWYVLERYVYCVTQRSYLTQEYQRESMLIDPPRKPSIDGFSSDSWLEMEEESCDQQPQEE
EKEEEEEEGEGADRVPKPPNGPVSPTNTTPEDQEVLGKKPKAPATRLLKRTLSNESEESV
KSSTIPADYPKTPTGSPATEVAAKWTHLTEFELKGLKALVEKLESLPENKKCVPEGIEDP
QALLEGVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPVLPHTAV
CLVCGEAGKEDTVEEEESKFNLMLMECSICNEIIHPGCLKIKESEGVVNDELPNCWECPK
CNHAGKTGKQKRGPGFKYASNLPGSLLKEQKMNRDNKEGQEPAKRRSECEEAPRRRSDEH
PKKVPPDGILRRKSDDVHLRRKRKYEKPQELSGRKRASTLQTSPGSSSHLSPRPPLGSSL
SPWWRSSLTYFQQQLKPGKEDKLFRKKRRSWKNSEDRLPLANKPLRRFKQEPEDDLPEAP
PKTRESDHSRSSSPTAGPSTEGAEGPEEKKKVKMRRKRRLPNKELSKELSKELNQEIQKT
ENSLANENHQPIKSEPESENEEPKRPLGLCDRPHRFSKGLNGTPRELRHQLGPGLRSPPR
VISRPPPSVSPPKCIQMERHVIRPPPISPPPDSLPLDDGAAHVMHREVWMAVFSYLSHQD
LCVCMRVCRTWNRWCCDKRLWTRIDLNHCKSITPLMLSGIIRRQPVSLDLSWTNISKKQL
SWLINRLPGLRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDN
RPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLTA
VGTTTRDSLTEINLSDCNKVTDQCLSFFKRCGNICHIDLRYCKQVTKEGCEQFIAEMSVS
VQFGQVEEKLLQKLS
Download sequence
Identical sequences ENSEEUP00000005597 ENSEEUP00000005597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]