SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005676 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005676
Domain Number 1 Region: 397-687
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-86
Family p120GAP domain-like 0.0000588
Further Details:      
 
Domain Number 2 Region: 275-354
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000379
Family Synaptotagmin-like (S variant) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005676   Gene: ENSEEUG00000006182   Transcript: ENSEEUT00000006218
Sequence length 1246
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8374:923:21543:1 gene:ENSEEUG00000006182 transcript:ENSEEUT00000006218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAIPPFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXYHLGRSRRKSVPGGKQYSMEAAPAAPFRPSQGFLSR
RLKSSIKRTKSQPKLDRTSSFRQILPRFRSADHDXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDDMLYARTSKPRSSGDTVWGEHFEFNNLP
AVRALRLHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLPTGSGGSGGMG
SGGGGGSGGGSGGKGKGGCPAVRLKARYQTMSILPMELYKEFAEYVTNHYRMLCAVLEPA
LNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEVDRFMEREHLIFRENTLATKAIEEYM
RLIGQKYLKDAIGEFIRALYESEENCEVDPIKCTASSLAEHQANLRMCCELALCKVVNSH
CVFPRELKEVFASWRLRCAERGREDIADRLISASLFLRFLCPAIMSPSLFGLMQEYPDEQ
TSRTLTLIAKVIQNLANFSKFTSKEDFLGFMNEFLELEWGSMQQFLYEISNLDTLTNSSS
FEGYIDLGRELSTLHALLWEVLPQLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXSIDLQSFMARGLNSSMDMARLPSPTKEKPPPPP
PGGGKDLFYVSRPPLARSSPAYCTSSSDITEPEQKMLSVNKSVSMLDLQGDGPGGRLNSS
SVSNLAAVGDLLHSSQASLTAALGLRPAPAGRLSQGSGSSITAAGMRLSQMGVTTDGVPA
QQLRIPLSFQNPLFHMAADGPGPPGGHGGGGSHGPPSSHHHHHHHHHHRGGEPPGDTFAP
FHGYSKSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLKPSITKQHSQTPSTLNPTMPASERTVAWV
SNMPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEE
YERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQVEKDSQIKSIIG
Download sequence
Identical sequences ENSEEUP00000005676 ENSEEUP00000005676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]