SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005693 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005693
Domain Number 1 Region: 226-264
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000213
Family PHD domain 0.00074
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005693
Domain Number - Region: 73-125
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000987
Family PHD domain 0.027
Further Details:      
 
Domain Number - Region: 199-234
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0379
Family Zn-finger domain of Sec23/24 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005693   Gene: ENSEEUG00000006249   Transcript: ENSEEUT00000006235
Sequence length 266
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_145:3419:11154:1 gene:ENSEEUG00000006249 transcript:ENSEEUT00000006235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTIKVKKKDHQRLRKPAKTKRVAQRRPPSGPXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXILSSKLPQRGQSNRGFHGFLPEDIKKEAARASRKVCYVCKQKGAAIHCQKDQCVRNF
HLPCGQESGCLSQFFGEYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXKYAHTSAKHFFKCPQCNNREEFPQEMLRMGIHIPDRDAAWELEPGAFL
DLYQRYQHCDAPICLYERGRDSFEDE
Download sequence
Identical sequences ENSEEUP00000005693 ENSEEUP00000005693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]