SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005790 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005790
Domain Number 1 Region: 326-413
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000547
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005790   Gene: ENSEEUG00000006341   Transcript: ENSEEUT00000006343
Sequence length 415
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5473:4480:26844:1 gene:ENSEEUG00000006341 transcript:ENSEEUT00000006343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQNSEREGSGPEVSPSVMPEAPPESPPAPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDG
VRYLLRWQMPLCSLLTCLGLNILFLTLNEGAWYSVGALVISVPALLGYLQEVCRTRLPES
ELMRRKYHSVRQEDLQRVRLSRPEAVAEVKSFLVQLEAFLSRLCCTCEAAYRVLHWENPI
VSSQFYGALLGTVCMLYLLPLCWVLALLNSTLFLGNVEFFRVVSEYRTSLKRRMNPTQEE
STTESPPPPDARGKSALPDSTPVSTPTELSFQDLTPGSVEEAEEAEPDEEFKDAIEETHL
VVLEDDDCAPCPAEDELVLQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGTCTGCSAT
FSVLKKRRSCSNCGNSFCSRCCSFKVPKSFMGATAPEAQRETVFVCASCNQTLSK
Download sequence
Identical sequences ENSEEUP00000005790 ENSEEUP00000005790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]