SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005862 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005862
Domain Number 1 Region: 5-140
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-29
Family BCR-homology GTPase activation domain (BH-domain) 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005862   Gene: ENSEEUG00000006409   Transcript: ENSEEUT00000006421
Sequence length 819
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8563:1188:14682:1 gene:ENSEEUG00000006409 transcript:ENSEEUT00000006421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKLDHGESCLSSAPPCDTAGLLKQFFRELPEPVLPADLHEALFKAQQLRTEDKSNATLLI
SCLMADHTIDVLRYFFNFLRNVSLRSSENKMDSSNLAVIFAPNLLQTSEIHEKMSANTEK
KLRLQAAVVQTLIEYASDIGHVPDFILEKIPAMLGVDGLCATPSLEGFEEGEYETPADCK
RKRRQSVGDFVSGALNKFKSNRTPSITPQQERNAQLSVSPVTLTPNAKRKLPVDSSHVVS
SKKRKSIKHNFNFELLPNNLFSTSSTPVSVHFDTSPEESSQSSLSPVVISGNHLGIDVPR
RSKRIASKKVSRVESGKAGCFSPKISRKEMVRRSLRLKFSLGKSSKDVNNTEYPVINRRE
NVGQRLANQQNLKNRIESVKTGLIFSPDIDERLARKGSKISKSSENLLTPERLHETSYRM
SWTGPTNSNFQEIDGNEASPSTGHLEVGNSALESDITVEKSPVSSYELTPSNVHSKHIDV
TGSSLSGDENNLTTETLEKVQKAFSESGSNIQALIHHGQSPITSVREVKSHETSIEYSPE
ENLFEANDLTVIESKEHHSNKDETSFSERDFSLQQMQEMNKETTKCHSTQIKMEHEKNIH
SDMTNNCLSKEELPGEQLKKEQTPKDKLDTELKEDENMIEESLLKYIASREDDITKTSSS
EKITSIETSFSKAKPVRIVKQQSLVETSEKMVSETLQTMEHGKVSDHIQWFNKLSLNEPN
RTKVKSPLKFQRTPVRQSVRRINSLLEYNRQPVRCKLLPGDAVSPLVKAVSCESALASCL
ESTSKDSSVSCLRSGPKEQKPTSCEQSNINVVSSSMELT
Download sequence
Identical sequences ENSEEUP00000005862 ENSEEUP00000005862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]