SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005892 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005892
Domain Number 1 Region: 849-1016
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000508
Further Details:      
 
Domain Number 2 Region: 384-491
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-21
Family DBL homology domain (DH-domain) 0.0014
Further Details:      
 
Domain Number 3 Region: 505-574,632-667
Classification Level Classification E-value
Superfamily PH domain-like 3.21e-16
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005892   Gene: ENSEEUG00000006401   Transcript: ENSEEUT00000006451
Sequence length 1070
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1326:123819:165675:1 gene:ENSEEUG00000006401 transcript:ENSEEUT00000006451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRRQAMQMERKKCQQGAGPGLGDLPRPSPRGRASEGSCGLDGDYEDAELNPRFLKDNLIH
ANGGGRPPWPPLEYQPYQSIYVGAMMGEGEGKGPLQRSQSTSEQERRLTWPRRSYSPRSF
EDSGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDSS
SPPTPQCQKRHRQGQVVVSEATIVGVRKTGQIWPSDGDSTFHGDTXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXASQLGVYRAFVDNYGVAMETAEKCCQANAQFAEISEN
LRARSNKDAKDQTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPSSHPDHPLLQDALRIS
QNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHIFLFTDLLLCTKLK
KQSGGKTQQYDCKWYIPLMDLSFQTVDESEALPNIPLVLDEELDTMKIKISQIKNDIQRE
KKANKGSKAIERLRKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDYERIEWRENI
REQQKKCFKSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLCGFLHVIVHSAS
GFKQSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLDPQTLQDRDWQRTVIAMNGIEVKLSVKFTSREFSLK
RMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQAL
KAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFTEGIALSDPVAKE
SCMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLHNLATVFGPTLLRPSEKESKL
PANPSQPISMTDSWSLEVMSQVHVLLYFLQLEAIPAPDSKRQSILFSTEV
Download sequence
Identical sequences ENSEEUP00000005892 ENSEEUP00000005892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]