SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005917 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005917
Domain Number 1 Region: 927-1076
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-30
Family BCR-homology GTPase activation domain (BH-domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 278-374
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-19
Family Pleckstrin-homology domain (PH domain) 0.00072
Further Details:      
 
Domain Number 3 Region: 1166-1313
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-18
Family Pleckstrin-homology domain (PH domain) 0.049
Further Details:      
 
Domain Number 4 Region: 8-63
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000139
Family SAM (sterile alpha motif) domain 0.004
Further Details:      
 
Domain Number 5 Region: 385-462
Classification Level Classification E-value
Superfamily PH domain-like 0.000000603
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 6 Region: 1123-1186
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000152
Family Ubiquitin-related 0.091
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005917
Domain Number - Region: 791-874
Classification Level Classification E-value
Superfamily PH domain-like 0.0962
Family Pleckstrin-homology domain (PH domain) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005917   Gene: ENSEEUG00000006358   Transcript: ENSEEUT00000006480
Sequence length 1535
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3557:266121:334155:-1 gene:ENSEEUG00000006358 transcript:ENSEEUT00000006480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPQDLDVTVWLATVHLEQYADTFRKHGLATAGAAQGLGDEELRQLGISATGHRKRILR
LLRAGATVSPPHSQSDSDMEPSPSPTPPAQPSKPVPKPRTVFTGLSGPATTQRPGLSPAL
WRPEVSRNLESSPKSPPLPTSSSEQSSTLNTMEMMPNAIYFGLDIRGEAQAAQDRTPDGC
QTAAPTPAHRPATGTVHIMDPGCLYYGVQPVGVPGDRREGRGVCQDRAEHGLRQEREDAG
YASLELPGESILSLPTLDIEETSDDLISPYASFSSTADRPTPLLSGWLDKLSPQGNYVFQ
RRFVQFNGRRLMYFGSDKGPFPKGXXXXXXXXXTRGSKDNKFQVITGQRVFVFRSESEAQ
RDMWCSTLQSCLKEQRLLGHPRPPQPPRPLRTGMLELRGHKAKVFAALSPGELALYKSEQ
AFSLGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGARXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWFS
PLSCHQLLGPGLLRLGRLWLRSPSHTALAPGLWLSGFGLLRGDHLFLCPAPGPGPPAPED
MVHLRRLQEISVVSAADTPDKKEHLVLVETGRLYLXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXLRLEGVYRKGGARARSLRLLAEFRRDARSVKLRP
GEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKEVIGSLPRVNR
RTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQELIDLYITDF
DIDCDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVSPTLTAEELT
NQVLEIRGTAPGTDLWVTFEIREHGELERPLHPKEKVLEQALQWCQLPEPCSASLLLRKV
SIAQAGCLFTGIRRESPRVGLLRCREEPPRLLGNRFQERFFLLRGRCLLLLKEKKSSKPE
REWPLEGAKVYLGVRKKLKPPTPWGFTLILEKMHLYLCCTEEDEMWDWTTSILKAQHDDQ
QPVVLRRRSSSDLARQKFGTMPLLPIRGDDSGASLLSANQTLRRLHNRRTLSMFFPMKSP
QGSVEEQEELEEPVYEEPVYEEVGAFPELTKDASTSFTTKEKTTRPETPFANQGSFDQTL
LSKTSSLGWEERPPDLPPGPPSKSSSQAHGSLEEQLLQELNSLILRKEEPAIGLGSPSQP
SSPQPASPNGLPAHTASFSTQPPCPPGPPSSQPLT
Download sequence
Identical sequences ENSEEUP00000005917 ENSEEUP00000005917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]