SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000005994 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000005994
Domain Number 1 Region: 1059-1078,1110-1322
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.83e-51
Family p120GAP domain-like 0.00046
Further Details:      
 
Domain Number 2 Region: 1541-1638
Classification Level Classification E-value
Superfamily RGC domain-like 5.23e-33
Family RGC domain 0.00000209
Further Details:      
 
Domain Number 3 Region: 613-816
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000077
Family Nucleotide and nucleoside kinases 0.051
Further Details:      
 
Domain Number 4 Region: 951-1017
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000169
Family p120GAP domain-like 0.028
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000005994
Domain Number - Region: 88-181
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0422
Family Calponin-homology domain, CH-domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000005994   Gene: ENSEEUG00000006453   Transcript: ENSEEUT00000006564
Sequence length 1638
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4431:62:66095:1 gene:ENSEEUG00000006453 transcript:ENSEEUT00000006564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLDNERLTAEEMDERRRQNVAYEYLCHLEEAKXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXATGLHFRHTDNVIQWLNAMDEIGLPKXXXXXXXXX
XXXXXXXXXXXXXXXXXLYLFKLGLAPQIQDLYGKVDFTEEEINNMKTELEKYGIQMPAF
SKIGGILANELSVDEAALHAAVIAINEAIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXMANAKNRTENSERERDVYEELLTQAEIQGNINKVNTLSALANVDRALEQG
AMLALLKALQSPALGLRGLQPQNGDWYLKQLLGDQQQKREGGQAEPLQKEELQCGVEAAN
SAAQQYQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETQDESAVLWLDEIQGGICQSNKDSLE
AQKFALGIFAINEAVDSGDVGRTLSALRSPDVGLYGVIPECGETYQSDLTEAKKKKLAAG
DNSSKWVKHWVKGGYHYYHNLQTQEGSWDEPPHFVQNSVQLSREEIQSSISGVTAAYNRE
QLWLANEGLITKLQACCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRL
ALLRSHKDEVVKIQSLARMHQARKRYRDRLQYFRDHINDIIKIQAFIRANKARDDYKTLI
NAEDPPMIVVRKFVHLLDQSDQDFQEELDLMKMREEVITLIRSNQQLENDLNLMDIKIGL
LVKNKITLQDVVSHSKKLTKKNKEQLSDMMMLNKQKGGLKALSKEKREKLEAYQHLFYLL
QTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLRLFKTALQEEIXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIMDDKSLNIKTDPVDIYKSWV
NQMESQTGEASKLPYDVTPEQALAHEEVKTRLDSSIRNMRAVTDKFLSAIVSSVDKIPYG
MRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAIVAPDAFDIIDLSAGGQLTT
DQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQKFRRFFQSACDVPELQDKF
NVDEYSDLVTLTKPIIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDDLGEVPTIES
LIGEGAGGLNDPNKEVLAKTEVSLTLTNKFDVPGDENAEMDARTILLNTKRLIVDVIRFQ
PGETLTEILETPATSEQEAEHQRAMQRRAIRDAKTPDKMKKSKSVKEDSNLTLQEKKEKI
QSGLKKLSELGTVEPKNRYQELINDIARDIRNQRRYRQRRKAELVKLQQTYAALNSKATF
YGEQVDYYKSYIKTCLDNLASKGKVSKKPREMKGKKSKKISLKYTAARLHEKGVLLEIED
LQASQFKNVIFEINPTEEVGDFEVKAKFMGVQMETFMLHYQDLLQLQYEGVAVMKLFDRA
KVNVNLLIFLLNKKFYGK
Download sequence
Identical sequences ENSEEUP00000005994 ENSEEUP00000005994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]