SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006004 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000006004
Domain Number - Region: 84-117
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000168
Family PHD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006004   Gene: ENSEEUG00000006593   Transcript: ENSEEUT00000006575
Sequence length 402
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3427:36843:62220:1 gene:ENSEEUG00000006593 transcript:ENSEEUT00000006575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTEKNAAYQYPRAILSVDLSGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXCEECLCWQHSLCMGLLEESIPEQYLCYVCRDPPXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXNKHHPDLRLWACSGKLEDRDHVVSGAEKATTARDTAPPEEKECSGQSPSEPPRLPFH
MEGTYITSEHSYQKPQTFGPDCRFPADPGSSDDDDVSSLEEHEFHMRDENHLQYLVKEDG
RPEKSPAAMFVYDDEKETEDPGDSHLQWQLNLLTHIENVQNEVTSRMDSIEKEVDVLESW
LDFTGELEPPDPLARLPQLKRHIKQLLLDMGKVQQIATLCSV
Download sequence
Identical sequences ENSEEUP00000006004 ENSEEUP00000006004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]