SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006273 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006273
Domain Number 1 Region: 8-133
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.62e-26
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006273   Gene: ENSEEUG00000006857   Transcript: ENSEEUT00000006874
Sequence length 860
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6861:10194:162420:1 gene:ENSEEUG00000006857 transcript:ENSEEUT00000006874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRKLDLSSLTDDETEHVLQVGQRDFNLRKKEEERLSEMKQKLDEEGSKCSILSKHQKFV
EHCCMRCCSPFTFLVNTKRCCGDCKFNVCKNCCSYQKHEKVWICCVCQQARLLRTQSLEW
FYNNVKSRFKRFGSAKVLKNLYRKHRLESGACCDVLGGNFFDANLENEGSISGSDSTFYR
HSEGHSMMDTLAVALRVAEEAIEEAISKAEAFGDSLDKQNEASYLRGHKEELTEELATTI
LQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSLVLRSPDGNWVALKD
DALGPSRLLAKPKTGTFQALEAASRVVSAYEEIGSDSEGDFDWSEALSTLCPQPRGPPRH
LQPLPAQAQGLDQGPSAASASSVLSPNPEAMCSDSETSSASSSREASHRARLSWLQRKAP
RNPSAEKMHLQAELDVNFNPQPGSRETSDSSEPEEAPDSPDRRARRWRRARGGTAEPGEE
LASPDAHPLELDPRQVLDDDLSETDISNETQHHWTSAGTTEEKVRNRLYELALKMSEKET
SSGEDQEYETKTESENQKESLSSEDNVQSVQEELKKKYSAVSLCNISTEVLKVINATEEL
IAESSGPWESPSVHPEKEKGTFPLGTDQVRLDEQLTSLEENVYLTXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISDIESRISALTMAGLNIAPCVRLT
RRRDQKLRSQVQTIITSRQQRRKLPTPPVKAEKTEASSVTTIKTLNHNFILQGSSTNRTK
EKENTTTDVMDPTPESAVMY
Download sequence
Identical sequences ENSEEUP00000006273 ENSEEUP00000006273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]