SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006658 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006658
Domain Number 1 Region: 1-137
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.71e-24
Family DEP domain 0.031
Further Details:      
 
Domain Number 2 Region: 263-284,562-658
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000000151
Family BCR-homology GTPase activation domain (BH-domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006658   Gene: ENSEEUG00000007247   Transcript: ENSEEUT00000007296
Sequence length 709
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_262:4488:19037:-1 gene:ENSEEUG00000007247 transcript:ENSEEUT00000007296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WNEVTLSFRAGMPLRKHRQHFKKHGNCFTAGEAVDWLYDLLRNNSNFGPEVTRQQTIQLL
RKFLKNHVIEDIKGRWGSENLDDNNQLFRFPATPLKAIPRRYPELRKNSTENFSKDKDSV
FKLRNLSRRTPKKLGIHFSQENMEKMDCEVVNDDQENSMDNREISQEDVEEVWRHSILTX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
PRSNDLSNPTYVGFERDVFRTIADYFLDLPEPLLTFEFYELFVNILVVCGYVTVSGRPSG
IHKTQDDPRSSKLLHLNCLNSFKSTECLLLSLLHKQEEPSTTEGLQNSQTFEKCTEIPQD
SLNRRTRAKWMMGGSGKLGLSSTQVRSSKHKSKCXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLCK
ALELSANSLPPAASVLTGPQNLLQPHLERVAIDALQLCCLLLPPPNRRKLQLLMRMISRM
SQNVDMPRLHDAMGTRSLMIHTFSRCVLCCAEEVDLDELLAARLVSFLMDHHQEILQVPS
YLQTAVESHLDYLKKGRVCMVKLLKILSISHLRAHSPVTSLIQKKRFAS
Download sequence
Identical sequences ENSEEUP00000006658 ENSEEUP00000006658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]