SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006760 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006760
Domain Number 1 Region: 249-442
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.91e-53
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 6-238
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.53e-42
Family BAR domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006760   Gene: ENSEEUG00000007373   Transcript: ENSEEUT00000007411
Sequence length 880
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1612:73:105320:-1 gene:ENSEEUG00000007373 transcript:ENSEEUT00000007411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSVCHHSHKRLIACFQGQHGT
DPERRHKKLPLTALAQNVQEASSQLKDSLLGKMLETCGDAENQLAFELSQHEVFVEKEIV
DPLYTIAEXXXXXXXXXXXXXXXXXXXXXXXXXXWNQAHKSSGTNFQGLPSKIDTLKEEM
DEAGNKVEQCKDQLAADMYNFMAREGEYGKFFVTLLEAQADYHRKALAVLEKALPEMRAH
QDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETGMKEEGLFRIGAGASKLKKLK
AALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASVQDQDKKLQDL
WRTCQKLPPQNFVNFRYLIKFLAKLAQTSDINKMTPSNIAIVLGPNLLWAKNEGTLAEMA
AATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLATPNSNHASHTGNDSDSGTLERK
RPASMAVMEGDLVKKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT
NSRVSEPLRSLFPEMVTDPSKDLPGRILLDMDNDTESTAL
Download sequence
Identical sequences ENSEEUP00000006760 ENSEEUP00000006760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]