SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006808 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006808
Domain Number 1 Region: 622-791
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.67e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.0000796
Further Details:      
 
Domain Number 2 Region: 96-264
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.31e-22
Family DBL homology domain (DH-domain) 0.0018
Further Details:      
 
Domain Number 3 Region: 481-534
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000982
Family Synaptotagmin-like (S variant) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006808   Gene: ENSEEUG00000007419   Transcript: ENSEEUT00000007466
Sequence length 837
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7419:15684:196474:-1 gene:ENSEEUG00000007419 transcript:ENSEEUT00000007466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSYGADDYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDSTSPTPPEGLAP
GXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMKPLKATATTSQPVLTIQQIETIFY
KIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDH
PDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGEXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXKHQQYDCEWYIPLADLVFPSPEESEASPKVHPLPDHELEDMK
MKISALKREIQKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXLQAFVLSSVELQVLTGSCFKLRTVHNIPVTSNKDDDESPG
LYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTMEPKWDEXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDPQTVETKNWQTDVIEMNGIKVE
FSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVRQCVEEVEKRGIEEVGI
YRISGVATDIQALKAVFDANNQDILLMLSDMDINAIAGTLKTFRELPEPLLTDRLYPAFM
EGIALSDPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGP
TLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV
Download sequence
Identical sequences ENSEEUP00000006808 ENSEEUP00000006808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]