SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006814 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006814
Domain Number 1 Region: 156-308
Classification Level Classification E-value
Superfamily E set domains 6.53e-55
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000236
Further Details:      
 
Domain Number 2 Region: 47-170
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.24e-19
Family Voltage-gated potassium channels 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006814   Gene: ENSEEUG00000007513   Transcript: ENSEEUT00000007472
Sequence length 308
Comment pep:novel scaffold:HEDGEHOG:scaffold_268069:4998:5921:1 gene:ENSEEUG00000007513 transcript:ENSEEUT00000007472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVAKVYYSQTTQTESRPLMGPGLRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFI
DMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLEPGPPANHTPCVVQVHTLTGAFL
FSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIR
FSQHAVVAAHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVAFQV
DTASDSPFLILPLTFYHVVDDTSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSY
LPEEILWG
Download sequence
Identical sequences ENSEEUP00000006814 ENSEEUP00000006814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]