SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000006857 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000006857
Domain Number 1 Region: 194-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000694
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 260-322
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000124
Family PHD domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000006857   Gene: ENSEEUG00000007539   Transcript: ENSEEUT00000007524
Sequence length 380
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3734:894:16677:1 gene:ENSEEUG00000007539 transcript:ENSEEUT00000007524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGEQYYKDAMEQCHNYNARLCAERSVRLPFLDSQTGVAQSNCYIWMEKRHRGPGLASGQL
YSYPARRWRKKRRAHPPEDPRLSFPSIKPDTDQTLKKEGLISQDGSSLEALLRTDPLEKR
GAPDPRVDDDSLGEFPVTNSRARKXXXXXXXXXXXXXXXXXXXXXPKRRGKGKSKGKGVG
SARKKLDAAILEDRDKPYACDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVS
QRPEEPKSKKGPDGLALPNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTP
VMMAAVKTYRWQCIECKCCNICGTSENDXXXXXXXXXXXXXXXXXXXXXXXXXXXXSWSC
HLCLDLLKEKASIYQNQNSS
Download sequence
Identical sequences ENSEEUP00000006857 ENSEEUP00000006857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]