SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007108 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007108
Domain Number 1 Region: 1349-1410
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.63e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0000287
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000007108
Domain Number - Region: 440-640
Classification Level Classification E-value
Superfamily Tropomyosin 0.000915
Family Tropomyosin 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007108   Gene: ENSEEUG00000007727   Transcript: ENSEEUT00000007802
Sequence length 1411
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8737:19488:109510:-1 gene:ENSEEUG00000007727 transcript:ENSEEUT00000007802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRILQRTPGRVGAQGSDLDSSATPINTVDVNNESSSEXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXEPKPDGLVADSSAELQSLERQLEEAQTENLKIKQMKDLFEQKAAXXXXXXXXIKSKYD
EEKSLREAADQKVIHLTEDLNKEATVIRDLKTELXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXATISQLRSELAKGPQEVAVYVQELQKLKSSMNEL
IQTNEKLNEKLLKKEREYTQLEEKHSEECVSKKNMRASLHQRDLDCQQLQSRVSASEASL
QRIQAELGEKGEAAHRLKEELSEVEAKYQHLKAEFKQLQQQREEKEQHGSQLQSEINQLH
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNLTESQ
HQLDKAKQQHQEQQALQQSTAARLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENIS
LLEKEREDLYAKIQAGEGETAVLNQLQEKNHMLHEQLIQLTEKLKNQSESHKQAQEDLHD
QVQEQKTHLRAAQDHVLSLEATVSELNGQLNESKEKVSQLDIQIKAKTELLLSAEAAKTA
QRADLQNHLDTAQNALQDKQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXKLETDILEVKASKEQVLQDLQQQRQLNTDLELKTTELSKQLEVEKEI
VSSTKLDLQKKSEALENIKQMLTKHEEEKLTLRQEIEKLNHGAKMQHKELSNRIQTSATE
LEKVKKEKEMLVTELSAAKEDLSKVSDSLKNSQSEIEKEKQKGKAAILNLEKTCKELKHQ
LQVQAENTQKEQSELKKSLEKEKESSHQLKLELKSVQGQVMQAQSSLKEKEKVEQQLQGS
INELKQLTEQKRKQVETLQGEVEVAVSQKTELENKLQQQLTQAAQELTAHREKLTALQST
YDRSQEHLNQLQSDFCGKESQLLAARQALKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLKEKELANEKSKLAEIEEIRSRQEKEV
TKLSEEFKSHKQESLKEVTNLKDAKQLLIQQKLELQGKVDSLKANLEQEKKNQQMFKEQV
QKEEDKLKKEFLEKEAKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXIKHTQALTRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNI
FCAECSAKNALTPSSKKPVRVCDACFNDLQG
Download sequence
Identical sequences ENSEEUP00000007108 ENSEEUP00000007108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]