SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007255 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007255
Domain Number 1 Region: 155-262
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-30
Family SH2 domain 0.000000627
Further Details:      
 
Domain Number 2 Region: 436-492
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000889
Family SH2 domain 0.000086
Further Details:      
 
Domain Number 3 Region: 4-44
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000053
Family BCR-homology GTPase activation domain (BH-domain) 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007255   Gene: ENSEEUG00000007972   Transcript: ENSEEUT00000007964
Sequence length 492
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8984:4373:23790:1 gene:ENSEEUG00000007972 transcript:ENSEEUT00000007964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AASMDLEMIDLQILADAFKRYLLDLPNPVIPVAVYSEMISLAQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLR
DTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHY
RNESLAQYNPKLDVKLLYPVSKYQQXQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYE
DYTRTSQEIQMKRTAIEAFNETIKIFGGQWQTQERYSKESIEKFKREGNTDIQXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVR
ESSKQGCYACSV
Download sequence
Identical sequences ENSEEUP00000007255 ENSEEUP00000007255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]