SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007438 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007438
Domain Number 1 Region: 1128-1188
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000664
Family PHD domain 0.0039
Further Details:      
 
Domain Number 2 Region: 281-325
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000532
Family PHD domain 0.005
Further Details:      
 
Domain Number 3 Region: 1203-1271
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000093
Family PHD domain 0.025
Further Details:      
 
Domain Number 4 Region: 1733-1783
Classification Level Classification E-value
Superfamily HMG-box 0.00000237
Family HMG-box 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000007438
Domain Number - Region: 1086-1136
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000792
Family PHD domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007438   Gene: ENSEEUG00000007930   Transcript: ENSEEUT00000008162
Sequence length 5089
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6608:3815:63945:-1 gene:ENSEEUG00000007930 transcript:ENSEEUT00000008162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQKPPGDKDPEQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPGNDSKMLVCETCDKGYHTF
CLQPPMEELPAHSWKCKACRVCRACGGGSAELNPDSEWFENYSLCHRCHKAQGSQPISSI
AEQPPPVCHRFSPPEPGDTPTDEPDALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLGR
AGAQLEPQLDAPIDEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPLPEESPLSPPPE
ESPLSPPPESSPFSPLEASPFSPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVSTDVSPAR
DEGSLRLCTDSLPETDDSLLCDAGAALGGGKAEGDKGRRRSSPARSRIKQGRSSSFPGRR
RPRGGAHGGRGRGRARLKSTASSVETLVVADIDSSPSKEEEDDDDDTMQNTVVLFSNTDK
FVLMQDMCVVCGSFGRGAEGHLLPGSKCSQCYHPYRVNSKITKVMLLKGWRCVECIVCEV
CGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQ
NSYTHCGPCASLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFD
CVSCQPYVVKPAAPVAPPESVPVKVKEPEPQYFRFEGVWLTETGMAVLRNLTMSPLHKRR
QRRGRPGLPGEAGLEGSEPPDALGSDDKKDGDLDADDLLKGEGGVEHMECEIKLEGPASP
DVEAGKEETEESKKRKRKPYRPGIGGFMVRQRKPHTRVKKRLAAQAEVLSGDGQPDEGET
VIATDLPAESSMDPGLADGDEKKKQQRRGRKKSKLEDMFPAYLQEAFFGKELLDLSRKAL
FAVGVGRPSFGLGAPKAKGDGGSDRKELPSLHKGDDGPDVADEESRGPEGKADTPGPEDG
GVKASPVPSDPEKPGTPGEGMLSSDLDRIPTEELPKMESKDLQQLFKDVLGSEREQHLGC
GTPGLDGSRTPLQRPFLQGGPLGSLPSSSPMGIPYPGLCQYTLLDSRERGGFFSPEPGEP
DSPWTGSGGTTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLYANINFP
NLKQDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHRISKVQKQAESQINKQTK
VGDMARKTDRPALHLRIPSQPGALGSPPPAAAPTIFIGSPTAPAAGLSTSADGFLKPPAG
TVPGPDSPGELFLKLPQVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXGQPPNFARSPGTGAFVGTPPPMRFTFPQAVGEPSLKPPVPQPSLPPPHGINSHFGPG
PTLGKPQSTDYTVATGNFHPSGSPLGPSSGSTGEGYGLSPLRPPSVLPPAPDGALPYLSH
GASQRAGITSPVDKREDPGAGMGSSLAAPELPGSQDPSMSNLSQTELEKQRQRQRLRELL
IRQQIQRNNLRQEKETAAAAAGAVGPPGGWGAEASGPAFEQLSRGQTPFSGTQDKSSLVG
LPPNKLGGPILGPGTFPTDDRLSRPPPPATPSSMDVSSRXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGRQTLSSPLAGIPPRLPGPGEPVPG
PAGPAQFIELRHNVQKGLGPGGAPFPGQGPPQRPRFYPLSEDSHRLAAEGLRGLAVPGLP
PQKPSAPPPAPELNNSLHPAPQAKGPTVPAGLELVSRPPSGTELGRPPPLALEAGKLPCE
DPELDDDFDAHKALEDDEELAHLGLGVDVAKGDDELGTLENLETNDPHLDDLLNGDEFDL
LAYTDPELDTGDKKDIFNEHLRLVESANEKAEREALLRGVEPGPLGPEERPPPAADAAEP
RLTSVLPEVKPKVEEGGRHPSPCQFSITAPKAEPAAATPSLGLGLKPAQSGVGNRDSRMG
PGPFPSSGQTAEKGPFGTTAGPPAHLLTSSPLSGPGGSTLLEKFELESGPLTLPGGHAAS
GDELDKMESSLVASELPLLIEDLLEHEKKELQKKQQLSAQLQPAQQPPQPQPQPPPLLSA
PGPAQAMPLPHENSAPGLAGPQQQLALGLGGPRQSSLTQPLMPTQPPAHAHQQRLAPSMA
MVSNQGHMMSGQHGGQAGLVPQQGPQPVLAQKPTGTMPHSMCMKPQPLAMPQQLANSFFP
DTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQVSLLAQRLSGGPGS
DLQNHVAARSGQDRSTGDPSQPRPNPPTFAQGVINEADQQQYEEWLFHTQQLLQMQLKVL
EEQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEH
TNLMAEYRNKQQQQQQQQQQQQQQHSAVLALSPSQSPRLLTKLPGQLLPGHGLQPPQGPP
GGQPGGLRLPPGSMALPGQPGGPFLNTALAQQQQQQHSGGPGPLAGPSGGFFPGNLALRG
LGPESRLLQERQLQLQQQRMQLAQKLQQQQQQQQQHHLLGQVAIQQQQQQGPGVQVNQAL
GSKPQGLLPPSSHQGLLVQQLSPQPPQGPQGMLGPAQVAVLQQQQQQHPGTLGPQGPHRQ
VLLTPSRVLSSPQLAQQGQGLMGHRLVASQQHQQQGSMAGLSHLQQGLITHSGQPKLNTQ
PMGSLQQQQLQQQQQQQQQQQLQQQQQQQQQQQQQQQLQQQQLQQQQQQQQLQQQQQQQL
QQQQQQLQQQQQLQQQQFQQQQQQQQMGLLNQGRTLLSPQQQQQQQVTLGPGMPAKPLQH
FSNPVALGSTLLLMGKDQSIVETPLPPEVTEGPATLQGGPLAVGPIPESVATEPGEVKPS
LSGDSQLVLVQPQAQAQPNSVQLQPPLRLPGQQQQQVLLHTAAVGNHGQTGSGSXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXGLLGRQPQLGGFPGPQTGPLQELGAGLRSQGPPRLPAPQGALSTGPVLGPVHPTL
PPSSPQEPKRPSSQLPSPNSQLPSDTQLTPNQPGTPKPQGPPLEMPPGRVSPAAAQLADT
FFGKGLGPWDPPDNLVEAQKPDQSSMVPGHLEQVNGQVVPEAPSLSIKQEPREEPCALGA
QAVKREANGEPVGAPGTSNHLLLAGPRSEAGHLLLQKLLRAKNVQLNTGRGPEGLRAEIN
GHIDSKLAGLEQKLQGPHSNKEDTAARKPLTPKPKRVQKASDRLVSSRKKLRKEDGVRAS
EALLKQLKQELSLLPLTEPTVTANFSLFAPFGSGSPISGQCQLRGAFGSGALSTGPDYYS
QLLTKNNLSNPPTPPSSLPPTPPPSVQQKMVNGVTASEELGEHPKDATSARETEGTLRDA
SEVKSLDLLAALPTPPHNQTEDVRMESDEDSDSPDSIVPASSXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXPHTLNSTSMKYQRTFTGETSTPYSKQ
Download sequence
Identical sequences ENSEEUP00000007438 ENSEEUP00000007438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]