SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007490 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007490
Domain Number 1 Region: 1232-1434
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.45e-30
Family p120GAP domain-like 0.032
Further Details:      
 
Domain Number 2 Region: 5-82
Classification Level Classification E-value
Superfamily Sema domain 2.22e-17
Family Sema domain 0.012
Further Details:      
 
Domain Number 3 Region: 427-521
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000042
Family Other IPT/TIG domains 0.006
Further Details:      
 
Domain Number 4 Region: 524-609
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000611
Family Other IPT/TIG domains 0.066
Further Details:      
 
Domain Number 5 Region: 79-131
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000128
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 6 Region: 378-411
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000314
Family Plexin repeat 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000007490
Domain Number - Region: 223-255
Classification Level Classification E-value
Superfamily Plexin repeat 0.0183
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007490   Gene: ENSEEUG00000008160   Transcript: ENSEEUT00000008219
Sequence length 1464
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_8740:9776:486657:-1 gene:ENSEEUG00000008160 transcript:ENSEEUT00000008219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDH
EHLYIMSERQLTRVPVESCGQYRSCSECLGSGDPHCGWCVLHNTCTRKERCERSQEPRRF
ASEMKQCVRLTVHPSNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSEMDGLVVGNQIQ
CYSPAAKEVPRIITENGDHHIVQLQLKSKETGMTFASTRFVFYNCSVHNSCLSCVESPYR
CHWCKYRHVCTHDPKTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPITLKAKNLPQPQ
SGQRGYECILSIQGSEQRVPALRFNSSSVQCQNTSXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXHLYKCGAMRESCGLCLKADPDFECGWCQAQGQCTLRQHCPLHESPWLELSGA
NSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVECSPLVDGYIPA
EQIVCEMGEAKPSQHAGFVEICVAICRPEFMARSSQLYYFMMLTLSDLKPSRGPMSGGTQ
VTITGTNLNAGSNVVVTFGKQPCLFHRRSPSYIVCNTTSSDEVLDMQLTVQVDRAKIHHQ
DLTFQYVEDPTIVRIEPEWSIVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLCEVLN
ETEMTCQAPALTLGPEHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYPNPVFEAFGPS
GILELKPGTPIILKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXARVGGMEYSPGMVYIAPDSPLSLPAIVSIAVAGGLLIIFIVAVLIAYKRKSRESDLT
LKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTYTMRVLFPGIE
DHPVLRDLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTESVAEKMLTNWFTFLLYKFL
KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLSCVNPDNA
NSSEIPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSGARMILQDEDI
TTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNVVNNSTVSRTSASKYENMIRYTGS
PDSLRSRTPMITPDLESGVKLWHLVKNHEHGDQKEGDRGSKMVSEIYLTRLLATKGTLQK
FVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKSNCLPLRFWVN
MIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSW
VERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNTISALSEIFSYVGKYSEEILGPLDH
DDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences ENSEEUP00000007490 ENSEEUP00000007490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]