SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000007579 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000007579
Domain Number 1 Region: 115-276,326-365
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.91e-29
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.015
Further Details:      
 
Domain Number 2 Region: 520-607
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000000366
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000007579   Gene: ENSEEUG00000008289   Transcript: ENSEEUT00000008319
Sequence length 784
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3770:3690:91916:-1 gene:ENSEEUG00000008289 transcript:ENSEEUT00000008319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWPRRAADGLSRWPRGLGLFLLLLQLRPRPGLGQDRLDAPPPPAAPLSRWSGPVGVSWG
LRAAAPEGPVPGGGRWRRSAPGEDEDCGGVLDFAARLANNTHQHVFDDLSGSVSLSWVGD
STGVILVLTTFHVPLVIMAFGQSKLYRSEDYGKTFKDITNLINNTFIRTEFGMAIGPENS
GKVILTAEVSGGSPGGRIFRSSDFAKNFVQTNLPFHPLTHPVRTPENSDYLLALSTENGL
WVSRNFGGKWEEIHKAVCLAKWGPKSIIFFTTHVNGSCKADLGTLELWRTSDLGKFQTIG
KIYSXXXXXXXXXXXXXXXXDTTRRIHVSTDHGDTWSMAQLPSVGQEQFYSILAANDDMV
FMHVDEPGXXXXXXXXXXXXXXXXXXXXXXXXXXXTTGGETDFTNVTSLRGVYITSVLSE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPHHYTILDSGGIIVAIEHSG
RPINVIKFSTDEGQCWKTYTFTKEPIYFTGLASEPGARSMNISIWGFTDSFLTRQWVSYT
IDFKDILNRNCEEKDYTIWLAHSTDPGDYGDGCILGYKEQYLRLRKSSVCQNGRDYVVTK
QPSICPCSLEDFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSKSNSVPIILATVGLMLVTIIAGVLIVKKY
VCGG
Download sequence
Identical sequences ENSEEUP00000007579 ENSEEUP00000007579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]