SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008010 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008010
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.51e-17
Family MBT repeat 0.0054
Further Details:      
 
Domain Number 2 Region: 636-696
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000213
Family PHD domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008010   Gene: ENSEEUG00000008753   Transcript: ENSEEUT00000008795
Sequence length 1004
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2075:4184:41592:1 gene:ENSEEUG00000008753 transcript:ENSEEUT00000008795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKHPPNRRGISFEVGAQLEARDRLKNWYPAHIEDIDYKEGKVLIHFKRWNHRYDEWFCW
DSPYLRPLEKIQLRKEGLQEEEGSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTYTVKF
YDGVVQTVKHIHVKAFSKDQSIGSTARPKETDQKRLSSSSDKREKFKDQRKATVNVKKDK
EDKAFKTEKRTKQPDKEGKLLCSEKGKVSEKSLPKNEKEDKENISEERYDQVDKKPENDF
VKSSEENLREKRKRGRPPSVAPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXQLKSVPEAGQVTSTLTCHSLGDGLEAAGLEMNCKSVGENIMKTEPASPFAELQEISTV
TVTNNLKKADEFVTSKALTVDLDHKFRCKVVDCLKFFRKAKLLHYHMKYFHGMEKSLEPE
ESPAKRHVQTRGSSASNKAIQEGLTRKRVSASSPXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXEDNLSESSSESFLWSDEEYSQDIDVTTNPDEELDGDERYDFEVVRCICEVQEENDFM
IQCEECQCWQHGVCMGLLEENVPEKYTCYVCQDPPGQRPSFKYWYDKEWLSRGHMNGLAF
LEDNYSHQNAKKIVATHQLLGDVQRVIEVLHGLQLKMSILQSREHPDLQLWCQPWKQHSR
EGRSHSKHIHVTETKLKEEIPSYRTLNGAVEKPLPLPLPRSVEESYITSEHCYQKPRAYY
PAVEQKLVVETRSSALDDSVNPLHENGDDSLSPRLGWPLDQDRSRGDNDSKPSPPKVKEY
VSKKVLPEEAPARKLLDRSGEGLLNSQHQWQFNLLTHVESLQDEVTHRMDSIEKELDVLE
SWLDYTGELEPPEPLARLPQLKHCIKQLLMDLGKVQQIALCCST
Download sequence
Identical sequences ENSEEUP00000008010 ENSEEUP00000008010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]