SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008058 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008058
Domain Number 1 Region: 39-103
Classification Level Classification E-value
Superfamily SH3-domain 8.53e-22
Family SH3-domain 0.00077
Further Details:      
 
Domain Number 2 Region: 117-182
Classification Level Classification E-value
Superfamily SH3-domain 1.24e-19
Family SH3-domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 189-222
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000327
Family SH2 domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008058   Gene: ENSEEUG00000008874   Transcript: ENSEEUT00000008847
Sequence length 223
Comment pep:novel scaffold:HEDGEHOG:scaffold_283691:7122:7892:-1 gene:ENSEEUG00000008874 transcript:ENSEEUT00000008847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGKAKRKASARDASPTPSTDAEYPANGGADRIYDLSIPALVKFAYAAEREDELSLVKGAR
VTVMEKCSDGWWRGSCGGQVGWFPSNYVLEEADEAAAEPPGLPGLRRGAPLSNGRALHLV
QTLYPFSSVTDEELNFDKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPG
PARSGRFAGREWYYGGVTRHQAECALNQRGVEGDFLVRDSESS
Download sequence
Identical sequences ENSEEUP00000008058 ENSEEUP00000008058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]