SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008093 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008093
Domain Number 1 Region: 458-599
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.85e-33
Family Synaptotagmin-like (S variant) 0.0022
Further Details:      
 
Domain Number 2 Region: 6-92
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.27e-17
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0066
Further Details:      
 
Domain Number 3 Region: 402-472
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000655
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008093   Gene: ENSEEUG00000008869   Transcript: ENSEEUT00000008883
Sequence length 636
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1557:68664:121983:-1 gene:ENSEEUG00000008869 transcript:ENSEEUT00000008883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLKNELLEIKRKGAKRGSQHYSDRTCARCQESLGRLTPKTNTCRGCNHLICRDCRIQESN
GIWRCKVCAKEIELKMATGDWFYDQKVNRFAYRTGSEIIRMSLRRKTAVNKREMVGQSLL
HQSEVGIIWPGRKIIQEQQKEPSVPFEVPKLKSGKYTLEAESESLDSYTADSDSTSRRDS
LDKSGLFPEWKKMSAPKSQVEKETQSGYQNVVSVDEDEMIFKKNTRKILRPSEYTKSVID
LRPEDVGHESGSLGDRSKSVPGLNMNKVKEEEEEEEDIDHLVKLHRQKLARSSMRSGSSM
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYEISESLLAQRILQFSVWHHGRFGRN
TFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKLPVGG
DRKKSKGGEGGELQVWIKEAKNLTAAKSGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLN
PHYNHTFVYNGIRLEDLQHMCLELTVWDREPLASNDFLGGVRLGFGTGISNGEVVDWMDS
TGEEVSLWQKMRQYPGSWAEGTLQLRSSMAKQKLGL
Download sequence
Identical sequences ENSEEUP00000008093 ENSEEUP00000008093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]