SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008196 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008196
Domain Number 1 Region: 40-90
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000165
Family Tudor domain 0.0079
Further Details:      
 
Domain Number 2 Region: 92-159
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000842
Family PHD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008196   Gene: ENSEEUG00000008976   Transcript: ENSEEUT00000008992
Sequence length 467
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2821:79615:101431:-1 gene:ENSEEUG00000008976 transcript:ENSEEUT00000008992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENQTLDPETRDSYGTSGHLPNKGSLTKTKNNFKDLMSKLTEGQYVLCRWTDGLYYLGKI
KRVSISKQSCLVTFEDNSKYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILICGKCG
LGYHQQCHIPIAGSADRPLLTPWFCRRCIFALAVRKGGALKKGAIARTLQAVKMVLSYQP
EELEWDSPHRTNQQQCYCYCGGPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFYL
FFCSVCNQGPEYIERLPLRWVDVVHLALYNLGVQSKKKYFDFEEILAFVNHHWELLQLGK
LTSTPVTDRGPHLLNALNSYKSRFLCGKEIKKKKCIFRLRIRVPPNPPGKLLPDKGLVPT
ENGAASELLRKRGKNKPGLLPHEFQQQKRRVYRRKRSKFLLEDAIPSSDFTSAWSTNHHL
ASIFDFSLDEIQSLKSASSGQTFFSDVDSTDAASTSGSASTSLSYDS
Download sequence
Identical sequences ENSEEUP00000008196 ENSEEUP00000008196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]