SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008304 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000008304
Domain Number - Region: 128-150
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0892
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008304   Gene: ENSEEUG00000009107   Transcript: ENSEEUT00000009112
Sequence length 236
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_71:160427:163826:1 gene:ENSEEUG00000009107 transcript:ENSEEUT00000009112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKHSVKTPLWRKDLDEPGTEEAEAEVEVEAAEEASEEEDEERNPEENDSLSERECLEEE
GEDERDGGSVSYSPLRQESSIQQVALLRRADSIWGWFSPFALLGGLAAPDRKRSLREEQC
VLETRRQRPRGGSCARCEILFCKKCGTLHSHPAYVEHGILEHPDLGERGCRGPRGVPIPS
LCILLPLRIRNSPFQHTLQKCPFSAVLSAPLWQGGPAQLRDSLSPTAPSEEPSTTW
Download sequence
Identical sequences ENSEEUP00000008304 ENSEEUP00000008304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]