SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008459 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008459
Domain Number 1 Region: 603-658,685-836
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-39
Family p120GAP domain-like 0.0000000376
Further Details:      
 
Domain Number 2 Region: 169-271
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-26
Family SH2 domain 0.0008
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-25
Family SH2 domain 0.00048
Further Details:      
 
Domain Number 4 Region: 415-487
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000171
Family Synaptotagmin-like (S variant) 0.055
Further Details:      
 
Domain Number 5 Region: 121-187
Classification Level Classification E-value
Superfamily SH3-domain 0.0000035
Family SH3-domain 0.0052
Further Details:      
 
Domain Number 6 Region: 357-407
Classification Level Classification E-value
Superfamily PH domain-like 0.0000202
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008459   Gene: ENSEEUG00000009239   Transcript: ENSEEUT00000009277
Sequence length 839
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4823:90:73859:1 gene:ENSEEUG00000009239 transcript:ENSEEUT00000009277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WYHGKLDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQTNIVNHFRIIAMCGDYY
IGGRRFSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEAXXXXXXXXXXXXXXXXXXXXXXX
FLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVXXXXXXXXXXXWFHGKISKQE
AYTLLMTVGQVCSFLVRPSDNTPGDYSLYFRTSENIQRFKICPTPNNQFMMGGRYYNSIG
DIIDHYRKEQIVEGYYLKEPVPMQDQEQVLSDTVDGKEIYNTIRRKTKDAFYKNIIKKGY
LLKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNC
FQIVVQHFSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKXXXXVSSLVLHI
EEAHKLPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSN
KTKKSKDPDIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXEATTLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLKNEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFVF
LRLICPAILNPRMFNIISXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPYMEGVNPFIK
SNKHRMIMFLDELGNVPELPDTAEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQ
Download sequence
Identical sequences ENSEEUP00000008459 ENSEEUP00000008459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]