SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008502 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008502
Domain Number 1 Region: 346-691
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.88e-38
Family Hect, E3 ligase catalytic domain 0.0092
Further Details:      
 
Domain Number 2 Region: 210-291
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.45e-28
Family PHD domain 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000008502
Domain Number - Region: 138-199
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00532
Family PHD domain 0.019
Further Details:      
 
Domain Number - Region: 73-106
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0508
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008502   Gene: ENSEEUG00000009316   Transcript: ENSEEUT00000009326
Sequence length 706
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1195:74579:118122:1 gene:ENSEEUG00000009316 transcript:ENSEEUT00000009326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNENKPGESQNLACVLCRKNDDCPNQYGEKKTNEKWNLTVHYYCLLMSSGIWQRGKEEEG
VYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNF
ASFCWHHRPVQIIASNNYGDSLPCTICLEFVEPIPTYNVLRSPCCKNAWFHRECLQVQAI
NAGMFFFRCTICNNSDVFQKEMLRMGIHIPEKDASWELEENAYQELLQHYEHCDVRRCRC
KEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNWECLECRTIIYNSGDFQKAKK
HTLVSANNVGITDCLLEESSPKLPRQSPGSQRKDVLRQGNKYRKDISTILTELAFQIKKK
PRRICINKDDIWNSALEGFRNQKFNPVYTIEVTYINENDHFGRDYPGSKQEFLSLLMLHL
ENSPLFEGSLSKNLSLNSQALKENLYFEAGKMVAISLVHGGPSLGFFSKTLFNCLAYGPE
NTQPILEDVLDFEVAQIIIRINTATNMSDLNSIINEYCNYFELIGCLRIVTSLSDKYVLV
KDILFYQVIKRVQAPFESFKQGLKTLGVLEKIQTYPEVFCDIFCHKPENLSAKILSDLFT
VHTLSDVQALNFWNSYLKAVEDGKSTTTMEDILNFATGCNSIPPAGFKPTPSIECLHMDF
PVGNKCSNCLTLPITTTYKEFQENMDFAIGNTLRLEKEKSSHYIGP
Download sequence
Identical sequences A0A1S2ZBN3
ENSEEUP00000008502 ENSEEUP00000008502 XP_007516901.1.11023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]