SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008523 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008523
Domain Number 1 Region: 43-139
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-31
Family Ras-binding domain, RBD 0.00000594
Further Details:      
 
Domain Number 2 Region: 358-429
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000417
Family SH2 domain 0.0000919
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000008523
Domain Number - Region: 219-290
Classification Level Classification E-value
Superfamily PH domain-like 0.000132
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008523   Gene: ENSEEUG00000009338   Transcript: ENSEEUT00000009348
Sequence length 430
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4526:8010:14720:1 gene:ENSEEUG00000009338 transcript:ENSEEUT00000009348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LREEELRATSLPSIPNPFPELCSPPSQSPILGGSSGTRGLLPRDASRPHVIKVYSEDGAC
RSVEVAAGATARYVCEMLVQRAHALSDENWGLVECHPQLALERGLEDHESVVEVQAAWPI
GGDSRFVFRKNFAKYELFKTSPHSLFPEKMVSSCLDAKADTSHEDLIQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPRHLQCVADVNESSVYVVTQGRKLY
GMPTDFGFCIKPNKLRNGHKGLHIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQLAQSRH
LRPSYVGSPPLRSVSDNTLVAMDFSGHAGRVIENPREALSAALEEAQAWRKKTNHRLSLP
TPSSGSSLSAAIHRTQPWFHGRISREESQRLIGQQGPVDGLCLRERKRKTQGVVLSLGHL
QKVYHHLILA
Download sequence
Identical sequences ENSEEUP00000008523 ENSEEUP00000008523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]