SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008535 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008535
Domain Number 1 Region: 916-1019
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 2.88e-29
Family Elongation factor TFIIS domain 2 0.0021
Further Details:      
 
Domain Number 2 Region: 704-769
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000184
Family PHD domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008535   Gene: ENSEEUG00000009324   Transcript: ENSEEUT00000009360
Sequence length 2032
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2780:4256:125579:1 gene:ENSEEUG00000009324 transcript:ENSEEUT00000009360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIVDTFNHLIPTEHLDDALFLGSNLENEVCEDFSTSQNVLEDSLKNMLSDKDPMLGSAS
NQFCLPVLDSNDPNFQMPCSTVVGLDDIMDEGVVKQSGSDAIDEELILPNRNLRDKVEEN
SVRSPRKSPRLMAQEQVRSLRQSTLAKRSNVAPVNSTKKASGKTVSAPKAGAKQSERCQI
KEEVCTSLKTEYYKENRRSSRHIGQIELASEVPVSSSHSAVSTYFEMKDEPGLDSKDMCN
NQGETNVSHELNCPLLSETCVSTEDRKSETLMECNSKTVSSPFLKFSDKEEHEQNDTISD
KMNETDTEEVRAKEYMKQESKDTVILPHEDDQITEETTSSLPVFGDAACTNPNKTEKSHV
DVSFSVDEVDECKLELENTLDVVDKVENSLQKHELEPVGYCEDKKSNDTQLESTEFNESK
IDVIGTSTFEQEPSHLENATGDSLDQNTKQLKIVENIKMESHETVNFQDEKNNQLSSVSC
LELKSIKSKHTKPLIHFKQNMTTDSMKKVTAKHGLVHSKTKVNVKSVKRNADELKSQQNF
HKSAKVRKKSDKDLKILACNSGVTSGKNQSHSILKKTSQDQNLLQVPKPLTHSLCDKPSS
HPGGSKDLQHPAQTGHALHSNQKQCHKPQQLAASTKTNSHVKEELEHAGVDFKEEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXNIATIKREGSDQISSFEAKYMWTPSKQCWFC
KKPHGNRFMVGCGRCDDWFHGDCVGLSLSQAQQMGEEDKEYVCMKCCAEEDKKTETVDPD
ILENQAKVDIHSEDKTMEYEKFGLVKHPPNDKTKYVDDTVKHKVKILKRESGEGKTSSDS
RDSEIKKWQLAPLRKMGQPILPRRSSEEKSEKIPKESVTTCTGEKASKQGAHEKQEMKKK
KSEKGVPSIHPSAASTAKPSADQIRQSVRHSLKDILMKRLTDSNLKVPEEKATKVATKIE
KELFSFFRDTDAKYKNKYRSLMFNLKDPKNNILFKKVLKGEVTPDHLIRMSPEELASKEL
AAWRRRENRHTIEMIEKEQREVERRPITKITHKGEIEIESDAPMKEQEAAMEIQESTANK
SSEKTEGSEKQKEDNDSMSKDTTSQHRQHLFDLNCKICIGRMAPPVDDLSPKKVKVVIGV
SRKHSDNEADSLADALSSTSNILSSEFFEEEKQESPKSAFSPAPRPEMPGTVEVESTFLA
RLNFIWKGFINMPSVAKLVTKAYPVSGSLEYLTEDLPDSIQVGGRISPQTVWDYVEKIKA
SGTKEICVVRFTPVTEEDQISYTLLFAYFSSRKRYGVAANNMKQVKDMYLIPLGATDKIP
HPLVPFDGPGLELHRPNLLLGLIIRQKLKRQHSASASASTSHTVEAPENVQIAVPPDKKS
KIEVSTEEAPEEESDFFNSFTTVLHKQRNKPQQTLQEDIPLLIEPLTEVTKQEPSKPLRF
LPGVLIGWENQPSTLDLANKPLPVDDILQSLLGTTDQVYEQDQSVMEQNTLKEIPFINEQ
ASPNAEKIDKMEVTDGEAKEVKVKADNLSESEGNSVVVEETPVMRSSISPGPLTNLSLRG
KPPDVSTEAFLTNLSIQSKQEETVENKERTLKKQLLPDQENNLQDNQTSNTSSSCRSNVG
KGNSDGNVSCSENIVANTRSPQFINLKRDPRQAAGRSQQIMSSESKDGDSCQNGEKNTLP
SLSNKEHLAEQVSVEEKLSSIEKTSCVQQSDDSGVAQNSPSVEKIHTSQAEQTKPLKEDT
LMQNIETLHQFRRGSTATSHFEGGSTCQSEFPSKTVNFTSRSTSPRASANFSLIRPQQPS
LQHLKSNPPGFTFPGPPNIPPQGMFGFPPHLPPPLLPPPGFGFAQNPMVPWPPVVHVTGQ
PQRMIGPLSQASRYIGPQNFYQVKDIRRPERRHSDPWGRQDQQQLDRPFNRVKGDRQRFY
SDSHHLKRERHDKEWDQESERHRRRDRPQDRDRKSREEGHKDKERARLSDRGADGKASRD
SRNVDKKQDKPKTEDHEKDKEREKSKHNREGEKDRDRYHKDRDHTDRAKSKR
Download sequence
Identical sequences ENSEEUP00000008535 ENSEEUP00000008535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]