SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008598 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008598
Domain Number 1 Region: 155-259,301-572
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.26e-146
Family Myotubularin-like phosphatases 0.0000000619
Further Details:      
 
Domain Number 2 Region: 49-131
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000205
Family GRAM domain 0.032
Further Details:      
 
Domain Number 3 Region: 1136-1175
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000101
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008598   Gene: ENSEEUG00000009406   Transcript: ENSEEUT00000009429
Sequence length 1193
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_2002:317:26330:-1 gene:ENSEEUG00000009406 transcript:ENSEEUT00000009429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLGRAADALIAISNYRLH
IKFKDSVINVPLRMIDSVESRDMFQLHIACKDSKVVRCHFSTFKQCQEWLSRLSRATARP
AKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIQCRQEAELTRMGFDLQNVWRVSHINS
NYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISWW
GWRNADDEYLVTSIAKACALDPGTRVTGGSLSTGNSDASEACDPDFDSSLTTCSGVESTA
APQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHAIRNSFHYLRAVCS
QMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVALA
KILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENAEDQNEQCPVFLQWLDSVHQLL
KQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNKNF
HNFLYTPGSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEENMDLYLSPVAQSQEFSGRS
LDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQEARIGLEPWHTNPEGSETSFLES
GVGGPQQTVGEMGLPPPLPTNQKDYLSSKPYNSHKNCSSSYTLLTTAMPREMKSNTSDPE
IKVLEETNVPALDTPAQDKPDRTLDGPGEPPEHCPEKEAMSRLSEIVSNKHDEICDFPES
SQDSLIAAPQLAQLESVLDMPSSCVPDHSLGTLYKPPSATCQTPADPSTDFLRQDTPVSA
ASISHQEQPSSVPDFIHGEEDSIKRGHNRSVQLLENPHFGKVPLELVRKPISQSQISEFS
FLGSNWDSFQGMVTSFPSGETTPRRLLSYGCCSRSSIKQMLAPGPCFGQWAQREGVKSPV
CSSHSNGHCSGPGGKNNRMWLSSHPKQVSSTKAVPLSCPSPVPPLYLDDDGLPFPTDVIQ
HRLRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMDYEDDFXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNCGNV
FCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQHLKKPIATASS
Download sequence
Identical sequences ENSEEUP00000008598 ENSEEUP00000008598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]