SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008689 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008689
Domain Number 1 Region: 2679-2884
Classification Level Classification E-value
Superfamily BEACH domain 1.06e-86
Family BEACH domain 0.000000284
Further Details:      
 
Domain Number 2 Region: 3033-3233,3396-3428
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.64e-31
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 3 Region: 3436-3504
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.06e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000008689
Domain Number - Region: 1410-1461,1513-1573,1606-1701
Classification Level Classification E-value
Superfamily ARM repeat 0.000173
Family HspBP1 domain 0.048
Further Details:      
 
Domain Number - Region: 2522-2566
Classification Level Classification E-value
Superfamily PH domain-like 0.00566
Family VPS36 N-terminal domain-like 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008689   Gene: ENSEEUG00000009307   Transcript: ENSEEUT00000009536
Sequence length 3513
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6055:112411:369523:-1 gene:ENSEEUG00000009307 transcript:ENSEEUT00000009536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPNTMIEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEINQSEEA
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEAVGGAQNELPLA
ERRGLLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVLM
TISRHGLSVNVVKYIHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXLEQAKEAESKDALKDLVNLITSLTTYGVSELKPAGVTTGAP
FLLPGFAVPQPAGKGHSVRNIQAFAVLQNAFLKAKTSFLAQIILDAITNIYMADNANYFI
LESQHTLSQFAEKISKLPEVQNKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSYHCSI
IAMRTLLKFTRHNYIFKDVFREVGLLEVMVNLLHKYAALLKDPTQALNDQGDSRNNSSIE
DQKHLALLVMETLTVLLQGSNTNAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXNGWERVNQNQVFELLLTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVR
FLGCFSDLRKISPMNVFPSNTQPFQRLLEDDMIAMDSVSPTLQHCSKLFIYLYKVATDSF
DSRAEQIPPCLTSESSLPSPWGTPALSRKRHAYHSVSTPPVYPLKSVADIKPHVATSSLQ
SSDAIIIHPGAMLAMLDLLASVGSVTQPDHALDLQLAVANILQSLVHAERNQQVMCEVGL
HARLLQRCSTALADEDHALHPPLQRMFERLASQALEPMVLREFLRLASPLNCGAWDKKLL
KQYRVHKPSSLSYEPEMRSSMITSMEGLGSDNVFSLHEDNHYRISKSLVKSAEGSTVPLT
RVKCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGCLFLPSLAPHNAPTNNAVTTGLTD
GAVVSGIGCGERFFPPPSGLSYSSWFCIEHFSSPPNNHPVRLLTIVRRANSSEQHYVCLA
MVLSAKDRSLIVSTKEELLQNYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLHYVHSTPGGSGSANPPVVSTVYAYIGTPPAQRHVAS
LVWRLGPTHFLEEVLPPSHVTSIFELGPNYVGSFQAVCMPCKDAKSEGVVPSPVALVPEE
KVSFGLYALSVSSLTVARIRKVYNKLDSKAIAKQLGLSSHENATPVKLIPNSAGHLNGPA
RTIGATLIGYLGVRTFVPRPVATTLQYIGGAAAILGLVAMASDVEGLYAAVKALVCVVKS
NPLASKEMERIKGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHETSIIPNSTAFQD
LLCDFEVWLHAPYELHLSLFEHFIELLTESSEAKNAKLMREFQLIPKLLLTLRDTSLSQP
TIAAISNVLSFLLQFPNSNDLLRFGQFISTLPTFAVCEKFVVMEIKNEEKLDPGSEEEFG
CLVSANIILLRNRLLDILLKLVYTSKEKTSINLQACEELVKTLGFDWIMMFMEEHLHSTT
VTAAMRILVVLLSNQSILIKFKEGLSGGGWLEQTDSVLTNKIGTVLGFNVGRSAGGRSTV
REINRDACHFPGFPVLQSFLPKHTNVPALYFLLMALFLQQPVSELPENLQVSVPVSSSRC
KQGCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPWQSEEEGSW
LREYPVTLMQFFRLHNVDASGMESDLCALAATVFPFNIRPYSEMVTDLDDEVGSPAEEFK
AFAADTGMNRSQSEYCNVGTKTYLTNHPAKKFVFDFLRFLKINLLSSASRQALGYNFLAS
PERSTRTQQKEFQTYILDSVMDHLLAADVLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXRQLLIKAVNRVWTELIHSKKQALEELFKVTLPVNERGHVDI
ATARPLIEEAGLKCWQNHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYEVPCK
EPETSDGIIPQKKPARYRRAISYDSKEYYMRLASGNPAIVQDAIVESSEGEATQQEPEHG
EDTIAKVKVLVKPPLKRSRSAPDGGDEENQEQLQDQIADGSSMEEEEKTDNASLLRLLEE
GEKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDVFTMTAPGKIRDXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEKSVTQRWERGEISNFQYLMHL
NTLAGRSYNDLMQYPVFPWVLADYDSEEVDLTNPKTFRNLAKPMGAQTDERLAQYKKRYK
DWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDLADRMFHSVREAW
YSASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVILPPWAKGDPREFIR
VHREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXLFKKPHPPKRVRSRLNGDVGISIPPGTTGDKIFFHHLDNLRPSLT
PVKELKEPVGQIVCTDKGILAVEQNKVLIPSTWNKTFAWGYADLSCRLGTYESDKAVTVY
ECLSEWGQILCAICPNPKLVITGGTSTVVCVWEMGTSKEKAKSLTLKQALLGHTDTVTCA
TASLAYHIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPVSALCINELTGDIVSCAGTHIH
VWSINGNPVVSVNTFTGRSQQIVCCCVSEMNEWDTQNVIVTGHSDGVVRFWRMEFLQVPE
TPAPESVEVLEMQEDCPETQIGQEVQDEDSSDSEVDEPSISQDPKDVPSQPGSTSHRPRA
ASCRATATWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRAHLQGPLSYPHPNPLD
TRNYSRLKPGYRWERQLVFRSKLTMHTAFDRKDNAHPAEITALGVSKDHSRILVGDSRGR
VFSWSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCGQLFCQKCSRFQSE
IKRLKISSPVRVCQNCYYNLQHERGTEDGPRNC
Download sequence
Identical sequences ENSEEUP00000008689 ENSEEUP00000008689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]