SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008690 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008690
Domain Number 1 Region: 371-654
Classification Level Classification E-value
Superfamily DNase I-like 2.09e-66
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000472
Further Details:      
 
Domain Number 2 Region: 811-979
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.03e-35
Family BCR-homology GTPase activation domain (BH-domain) 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008690   Gene: ENSEEUG00000009492   Transcript: ENSEEUT00000009537
Sequence length 983
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7913:97936:196467:-1 gene:ENSEEUG00000009492 transcript:ENSEEUT00000009537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQSVAIQETLAAGEYCIIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRM
AITGEDVSLDQIVPVSRDFTLEEVSPDGEIYILGSDVTVQLDTADLSLLFQLPFGSHTRT
FLQEVARACSGFHPTTRDPQFLWLSQHRCNKPEPKEPMPRGWNLGTPRHARIGRGRCPSR
KERGLERQGAGRVLRGGAVRHTGLRLAQVEPGGGSLCGGRCWRCDEKLEEAGREMSAAAS
SREGDSAGGSHLEDSKPNGKGPLVDQSSWSQEKLETMLPXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXFQELDLSKEAFFFHDTPKEEEWFKAVSDALHPDAKYAKVKLIRLVGIMLL
LYVKQEHAAHISDVEAETVGTGIMGRMGNKGGVAIRFQLHNTSICVVNSHLAAHTEEYER
RNQDYKDICSRMQFYQVDPSLPPLTINKHDVILWLGDLNYRIEELDVEKVKKLIEEKSFQ
ILYTYDQLKNQVAAKAVFEGFTEGELTFQPTYKYDTGSNDWDTSEKCRAPAWCDRILWKG
KNITQLSYQSHMALKTSDHKPVSSVFDIGVRVVNEELYRKTLEEIVRSLDKMENANIPSV
SLSKREFCFQNVKYMELQVQSFTIHNGQVPCQFEFINKPHEDSYCKQWLSANPSRGFLFP
DSAIDINLELFVNKNSATKLNSGEDKIEDILVLHLDRGKDYFLSVSGNYLPSCFGSPIHT
LCYMKEPILDLPLETIRDLTLMPLRTEDGESSLEKPLEIPKELWMMVDYLYRNAIHQEDL
FQQPGLRSDFQKVRDCLDKGTVDDLSASNHSVAEALLLFLESLPEPVICYSAYHNCLECS
GNYTASKQVISTLPSFHRNVFNYLMAFLQELLKNSSKNHLDENILASIFGSLLLRNPAGH
QKLEMVEKKKAQEFIHQYLCNSS
Download sequence
Identical sequences ENSEEUP00000008690 ENSEEUP00000008690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]