SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008691 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008691
Domain Number 1 Region: 540-695
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-42
Family BCR-homology GTPase activation domain (BH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 27-170
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.03e-23
Family FCH domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008691   Gene: ENSEEUG00000009481   Transcript: ENSEEUT00000009538
Sequence length 901
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1130:521:17984:-1 gene:ENSEEUG00000009481 transcript:ENSEEUT00000009538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATHGKLRRERGPQAEYEAQVKEMRWQLSEQLRCLELQGELRRELLQELAEFMRRRAEVE
LEYSRGLERLAERFSGRSARLGGSREHQNFRKEPALLSPLHCWAVLLQQTRQQSRESAVL
SDVLAGSLAQRLSHIAEDVGRIVKKSKDLEQKLQEELLEVVSELRTAKKTPAYLIKSVNP
EAKLLQAEWQEEEAAGGTSPVAPATTSEAGACDFVRTEGGLXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXVADIRVELELRDEILPRARNIQSRLDRQTIETEEVNKTL
QATLQALLEVVASDDGDTLDAFQACPSTESLKSTSSDPGVRQAGRRRGQQQETETFYLTK
LQEYLNGRSVLAKLQAKHEKLQEAIQRGDKEATGVARAQYIQRKFPKSCLPRPSSQYNQK
LFGGGMEKFIQSSGQPVPLVVESCVRFINLHGLQHEGIFRVSGAQPRVTEIREAFERGED
PLVEGCSTHDLDSVAGVLKLYFRSLEAPLFPPELFGELLAAVEVEETSERVEQVSRLLAR
LPGPVLVVLRYLFTFLSHLAQYSDENMMDPYNLAXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXAERQASRQRSTAAGSPEGLLAVLIHRPELYTPPEAGGPSGHRRHCLVPTSPERLVEMD
R
Download sequence
Identical sequences ENSEEUP00000008691 ENSEEUP00000008691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]