SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008717 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008717
Domain Number 1 Region: 23-98
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.0048
Further Details:      
 
Domain Number 2 Region: 93-158
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000314
Family Fibronectin type I module 0.049
Further Details:      
 
Domain Number 3 Region: 222-265
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000314
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008717   Gene: ENSEEUG00000009573   Transcript: ENSEEUT00000009566
Sequence length 374
Comment pep:novel scaffold:HEDGEHOG:scaffold_367158:3815:6357:1 gene:ENSEEUG00000009573 transcript:ENSEEUT00000009566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRKVAVVVTLLHLSWRALSTCPAACRCPLEAPQCAPGVGLVRDGCGCCKVCARQLNEDCS
RAQPCDHTKGLECNFGASSAALRGICRAQSEVRPCEYNSRIYQNGESFQPNCKHQCTCID
GAVGCIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCDEDGAREPVDGLLDKDLAFDAS
EVELTRNNELIAVGKGDSLKQLPVFGLEPRILYNPSFHDQKCIIQTTSWSQCSKTCGTGI
STRVTNDNPECRLLKETRICEVRPCGQPVYSSLKKGKKCSKTKKSPEPVKFTYAGCSSVK
KYRPKYCGSCVDGRCCTPQQTRTVKMRFRCEDGETFSKNVMMIQSCRCNYNCPHANEAAF
PFYRLFNDIHKFRD
Download sequence
Identical sequences ENSEEUP00000008717 ENSEEUP00000008717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]