SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008770 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008770
Domain Number 1 Region: 7-197
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.99e-43
Family BAR domain 0.025
Further Details:      
 
Domain Number 2 Region: 388-508
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-28
Family BCR-homology GTPase activation domain (BH-domain) 0.000000568
Further Details:      
 
Domain Number 3 Region: 661-681,755-810
Classification Level Classification E-value
Superfamily SH3-domain 1.1e-16
Family SH3-domain 0.0000409
Further Details:      
 
Domain Number 4 Region: 313-363
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000688
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008770   Gene: ENSEEUG00000009556   Transcript: ENSEEUT00000009624
Sequence length 811
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_4837:7870:451125:1 gene:ENSEEUG00000009556 transcript:ENSEEUT00000009624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVPAFEFHRCSLDSLFRESFKVHESLDKTINFFKELLKDSKTLISAIKNLSSAKRKFAD
SLNEFKFQCIGDAETDDEMCIARSLQEFATVLRNLEDERIRMIENASEVLITPLEKFRKE
QIGAAKEAKKKYDKETEKYCGILDKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLGYV
FKVQEVQERKMFEFVEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXGEDESVPLKPCTRWKTDIIEKRFCFDVEAVDRPGVITMQALSEEDRRLWME
AMDGREPVYNSNKDSSETAQLDSIGFNIIRKCIHAVETRGINEQGLYRIVGVNSRVQKLL
SVLMDPKTASETDTDVCAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLENQES
RVSEIHSLVHRLPEKNRQMLQLLMNHLAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXIFNTVPDVPLTNAQLHLSRKKSSDSKPPSCSERPLTLF
HAVQSTEKQEQRNSIINSSLESVTSSNTNSILNSSSSLQPNMNSSDPDLDVLKPTRPNSL
PPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPIRSVAGFVWFSVAAVALSLAWSSLH
AVFSLLVNFVPCHPNLHLLFDRPEEAVREEYSTPFRKAKALYACKAEHDSELSFSAGTIF
DNVHPSQEPGWLEGTLNGKTGLIPENYVEFL
Download sequence
Identical sequences ENSEEUP00000008770 ENSEEUP00000008770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]