SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008828 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008828
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-32
Family V set domains (antibody variable domain-like) 0.0000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008828   Gene: ENSEEUG00000009716   Transcript: ENSEEUT00000009686
Sequence length 104
Comment pep:novel scaffold:HEDGEHOG:scaffold_255737:665:976:-1 gene:ENSEEUG00000009716 transcript:ENSEEUT00000009686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVKLQELGPGLVRPSETLYLTCSVSGESISSSNSWDSIRQPTGKGLEWIGYIHGSDGNTY
YSPSMKNQATNSKDISKNQFSMNLSYVTAEDTAMYYCARNTVRG
Download sequence
Identical sequences ENSEEUP00000008828 ENSEEUP00000008828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]