SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008939 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008939
Domain Number 1 Region: 5-80
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000174
Family SH3-domain 0.0001
Further Details:      
 
Domain Number 2 Region: 157-258
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000255
Family BCR-homology GTPase activation domain (BH-domain) 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008939   Gene: ENSEEUG00000009774   Transcript: ENSEEUT00000009809
Sequence length 570
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1814:1627:7381:1 gene:ENSEEUG00000009774 transcript:ENSEEUT00000009809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASADGFQYRALYPFCRERPEDLELLPGDRLVVSRAALQALGVSEGGERCPQRVGWMPGF
NERTHQRGDFPGTYVEFLGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXLDGESVYRPELPAPRTDWTLGDLEQWQPAALADGIKAFLLA
LPVPLLTPEAVAEALRALREAAGPVGPALEPPTLPLHRALTLRFLLQHLGRLARRAPAPG
PAIHALGAALGPLLLPPPLGGAPEGPEPTPDFPALLLEKLLQEHLAEQEVPXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXDQIVKEDSVEAVSAQLKVYHQQYQEKSREYGQLYEEYTRTSQELQMKRTAIEAFNETI
KIFEEQGQTQEKCSKEYLERFRQEGNEKEMQRILLNSERLKSSIAEIHESRTKLEQELRA
QACDNREIDKRMNSLKPDLKQLRKIRDQYL
Download sequence
Identical sequences ENSEEUP00000008939 ENSEEUP00000008939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]