SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000008985 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000008985
Domain Number 1 Region: 1248-1340
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.87e-23
Family BCR-homology GTPase activation domain (BH-domain) 0.00073
Further Details:      
 
Domain Number 2 Region: 36-148
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000071
Family G proteins 0.0055
Further Details:      
 
Domain Number 3 Region: 315-376
Classification Level Classification E-value
Superfamily FF domain 0.000000523
Family FF domain 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000008985
Domain Number - Region: 369-436
Classification Level Classification E-value
Superfamily FF domain 0.0196
Family FF domain 0.0033
Further Details:      
 
Domain Number - Region: 167-217
Classification Level Classification E-value
Superfamily FF domain 0.0243
Family FF domain 0.0068
Further Details:      
 
Domain Number - Region: 1179-1205
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0471
Family BCR-homology GTPase activation domain (BH-domain) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000008985   Gene: ENSEEUG00000009852   Transcript: ENSEEUT00000009861
Sequence length 1348
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1422:3265:23762:1 gene:ENSEEUG00000009852 transcript:ENSEEUT00000009861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLQPYIKRAAASKQSAELMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRK
FDDQLKFVNNLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFN
VNIETCFTALVQMLDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKT
VSNKLKNHPDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLLPN
LEEIEHLNWSEALKLMEKRAEFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEK
VYQNHVQHLISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSK
EVYGRHQREIVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQ
KLAPDRESLLLKHIGFVYHPTKETCLSGQNCTDIKVEQLLASSLLQLDHGRLRLYHDSTN
IDKVNLFILGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYFLSQLWTAA
FKPHGCFCVFNSIESLNFIGEFIGKIRTEASQIRKDKYMTNLPFTLILANQRDSTSKNLP
ILRHQGQQLANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLESVKHNLDVVSPVPTNKD
VAEADLRIVMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQIT
VLSYHSSIGVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFF
ENEAIKELMTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKIMIENSYLSD
NTRESTHQSEDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRL
DLEGNEYPIHSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRK
QTSRVPLAHPEDMDASDNYAEPIDTIFKQKGYTDEIYVLPDDSQNRIIKIRNSFVNNTQG
DEENGFSDRISKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGR
HRGSEEDPLLSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLCTEGLYRVSGNKTDQDNIQKQ
FDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIPDKTERLHALK
EIVKKFHPVNYDVFRYIITHLNRVSQQNKTNLMTADNLSICFWPTLMRPDFENREFLSTT
KIHQSVVETFIQQCQFFFYNGDIVETVN
Download sequence
Identical sequences ENSEEUP00000008985 ENSEEUP00000008985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]