SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009012 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009012
Domain Number 1 Region: 678-710
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000959
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009012   Gene: ENSEEUG00000009869   Transcript: ENSEEUT00000009890
Sequence length 1409
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_5585:16122:103013:1 gene:ENSEEUG00000009869 transcript:ENSEEUT00000009890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENYFQAEAYNLDKVLDEFEQNEDETVPPILLDTKWNKIVDSSSHRLSFNSALTSVSEPA
APNESEPKLKVFSLAHSSPLSTEEEDHSANGQDCCLNPEVSAMWIDESVVAKDQLIKRNC
NQDDQCSAVEVGENKCGNLACLPDDKNVLVVAVMHNCDKRTLQSDLQDCNNYNSQNLMDA
FSCSLDNENRQTDQFNLSINGSTEKDMNSEKQMDPMPRPNTEGDSVKHLCTTSSDNLASI
CSPLQLKDDENIGRDPSTSGISSVVVDSVISSQVADEDSAGKKQEEVLMGKTGSPTPDLG
SPNSFSHLNEEILMMEEPAEERTIEESVQSGLLLKSDIPSGSGRDDYCGQFSDSLMPSDE
NKSCEPEEILGTTDLNMTEHFSDSQEKTNWKLTKLNEMSDSQVNKENEKFVQMNQPEDTC
NNNGECNRVAEANLDLKGTCMKESEGCDFSSATDTPAANPLSNCDSYGMQSPVCFVPKTL
PSKEDSVTEEKEIEESKSECYSNIYEHRGNEGTEGSGLLLNSPGDLVKKNYSHNFCSQSP
SMLGQSSPKIIANLQSISVPFGGARPKQPSNLKLQIPKPLSDHLQDLPANSGNNIKNKND
VLGKTKLGENTATNICNTSLGTISIADTNGEHLESYEAGVSSRPCLALAPDSPDNDLRAG
QFGISARKSFTTLGEVAPVWVPDSQAPNCMKCEARFTFTKRRHHCRACGKXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAQAWENMMSASSQSPNPNNPXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAQPREQRRVWFADGILPNGEVADATKLTTNGTSSAGT
LAVSHDPVKPVTTSPLPAETDISLFSGSITQVGSPVGSAMNLIPKDGLPPILISTGVKGD
YAVEEKPSQISVMQQLEDGGPDPLVFVLNANLLSMVKIVNYVNRKCWCFTTKGMHAVGQS
EIIILLQCLPDEKCLPKDIFNHFVQLYRDALAGNVVGNLGHSFFSQSFLGSKEHGGFLYV
TATYQSLQDLVLPTPPYLFGILIQKWETPWAKVFPIRLMLRLGAEYRLYPCPLFSVRFRK
PLFGETGHTIMNLLADFRNYQYTLPVVQGLVVDMEVRKTSIKIPSNRYNEXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGASFFVFSGALKSSSGYL
AKSSIVEDGVMVQITAENMEALRQALREMKDFTITCGKADAEDPQEQIHIQWVDDDKNVN
KGVISPIDGKSMESITSVKIFHGSEYKANGKVIRWTEVFFLENDDQHSCLSDPADHSRLT
EHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQVGYQAGSNGQPLPSQYMNDLDSAL
VPVIHGGACQLSEGPIVMELIFYILENIA
Download sequence
Identical sequences ENSEEUP00000009012 ENSEEUP00000009012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]