SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009156 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009156
Domain Number 1 Region: 73-140
Classification Level Classification E-value
Superfamily HMG-box 1.7e-20
Family HMG-box 0.00027
Further Details:      
 
Domain Number 2 Region: 11-63
Classification Level Classification E-value
Superfamily HMG-box 0.00000000982
Family HMG-box 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009156   Gene: ENSEEUG00000010053   Transcript: ENSEEUT00000010041
Sequence length 178
Comment pep:novel scaffold:HEDGEHOG:scaffold_191124:241:868:1 gene:ENSEEUG00000010053 transcript:ENSEEUT00000010041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKRKRISTGGLFLRMCKVEHQETKPGAGMNLTAFSKKGSKRWRMLSEEEKNAFRDLARAE
RERNDPQTRGHGPERERDANAPKRALSAFFLFYSDFRPKVKAAYPDITSGNLSKKLGEMW
SHLSNMEKRLYEDKAAQLRMQPWIWMVSLLTLHRRSWKQIKSQKIQRGTRRRRKTMNK
Download sequence
Identical sequences ENSEEUP00000009156 ENSEEUP00000009156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]