SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009272 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009272
Domain Number 1 Region: 4-460
Classification Level Classification E-value
Superfamily Sema domain 3.4e-167
Family Sema domain 0.000000000951
Further Details:      
 
Domain Number 2 Region: 463-513
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000562
Family Plexin repeat 0.00093
Further Details:      
 
Domain Number 3 Region: 519-595
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000051
Family V set domains (antibody variable domain-like) 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009272   Gene: ENSEEUG00000010168   Transcript: ENSEEUT00000010168
Sequence length 796
Comment pep:novel scaffold:HEDGEHOG:scaffold_369604:40709:46023:1 gene:ENSEEUG00000010168 transcript:ENSEEUT00000010168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LATVVRRFSQTGIQDFLTLTLTEQTGLLYVGAREVLFAFSVEALELQGMINWEAPVEKKA
ECVQKGKSNQTECFNFIRFLQPYNTSHLYVCGTYAFQPKCTYIDIVTFTLEHRKVEDGKG
KCPYDPTKGHTGLLVDGELYSATLNNFLGTEPVILRNMGPHHPMKTEYLAFWLNEPHFVA
SAYIPESVGSFTGDDDKIYFFFSERAVEYDCYAEQVVARVARVCKGDMGGARTLQRKWTT
FLKARLVCSVPDWQLYFNQLQALFTLQNASWHNTTFFGVFRARWGDVDLSAVCEYQLEEI
QKVFEGPYKEYREQVQKWGRYTDPVPSPRPGSCINDWHRHHGYTSSLELPDNTLNFIKKH
PLMEDQVGPRWGRPLLVKKDTNFTRLVANRVTGLDGATYTVLFIGTGDGWLLKAVSLGPW
VHLIEELQVFDQEPVESLVLSQSKKLLFAGSRSQLVQLPLSDCIKYRSCADCLLARDPYC
AWNVNTSRCVAVHGHSGSQLIQHVSVSDTSGICSFHGSKKVRLTPKNITVVAGTDLVLPC
HLSSNLAHAHWTFGGRDLPVEQPGSFLYDARLQALVVMSAQPRHAGVYHCFSEEQGARLA
AEGYLVAVVAGPSVTLEARAPLENLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKG
AKAAERTLVYPLELPKEPTSPPFRPGPETDEKLWDPVGYYYSDGSLKIVPGHARCQPGGG
PPSPPPGIPGQPLPSPTRLHLGGGRNSNANGYVRLQLGGDDRGGHGHPLPEVADELRRKL
QQRQPLPDSNPEESSV
Download sequence
Identical sequences ENSEEUP00000009272 ENSEEUP00000009272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]