SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009301 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009301
Domain Number 1 Region: 153-329
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.04e-38
Family Asparaginyl hydroxylase-like 0.052
Further Details:      
 
Domain Number 2 Region: 1021-1135
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000334
Family 28-residue LRR 0.043
Further Details:      
 
Domain Number 3 Region: 880-907
Classification Level Classification E-value
Superfamily F-box domain 0.00000222
Family F-box domain 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000009301
Domain Number - Region: 598-662
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000182
Family PHD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009301   Gene: ENSEEUG00000010174   Transcript: ENSEEUT00000010199
Sequence length 1147
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7141:4750:41508:1 gene:ENSEEUG00000010174 transcript:ENSEEUT00000010199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTDKYGADFVTFMEGKXXXXXXXXXXXXXX
XXXXXXXXXXXXXMPDADFTVNDVKMCVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVDLIDWVDNMWPRHLKESQTESTNAILEMQYP
KVQKYCLMSVRGCYTDFHVDFGGTSVWYHIHQGGKVFWLIPPTAHNLELYENWLLSGKQG
DIFLGDRVSDCQRIELKQGYTFVIPSGWIHAVYTPMDTLVFGGNFLHSFNIPMQLKIYNI
EDRTRVPNKFRYPFYYEMCWYVLERYVYCITSRSHLTKEFQRESLSMDLELNGLESGNGD
DGAEREPRRLSGRRSVLTSPVANGVNLDYDGLGKACRSLPSLKKSLSGDSSSDSGRGSHN
GQVWDPQCSPRKDKQVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKVL
LEELAHSDPKLALTGVPIVQWPKRDKLKFPARPKVRVPTIPITKPHTMKPAPRLTPVRPA
AASPIVSGARRRRVRCRKCKACVQGECGVCHYCRDMKKFGGPGRMKQSCVLRQCLAPRLP
HSVTCSLCGEVDQNEETQDFEKKLMECCVCNEIVHPGCLMDGEGLLNDELPNCWECPKCY
QEDGSEKAQKRKMEESDDEAVRAKVLRPLRSCDEPLTPPPHSPTSMLQLIHDPVSPRGVG
TRSSPGAGPSDHHSASRDERFKRRQLLRLQATERTMVREKENNPSGKKELSGGGKAKIRG
SYLTVTLQRPAKELPGTSIVPKLQAITASSANLRHSPRVLVQHCPARGPQRGDEEGLGAE
DEDAEDEDDEDDDSAEEADVVRLNGRGAGAQDGDGSWMQREVWMSVFRYLSRRELCECMR
VCKTWYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQDNR
SKLRNMTDFRLAGLDITDATLRLIIRHMPLLSRLDLSHCSHLTDQSSNLLTAVGSSTRYS
LTELNMAGCNKLTDQTLIYLRRIANVTLIDLRGCKQITRKACEHFISDLSINSLYCLSDE
KLIQKIS
Download sequence
Identical sequences ENSEEUP00000009301 ENSEEUP00000009301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]