SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009440 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009440
Domain Number 1 Region: 160-300
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.73e-35
Family BCR-homology GTPase activation domain (BH-domain) 0.000000199
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000000000112
Family CRAL/TRIO domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009440   Gene: ENSEEUG00000010355   Transcript: ENSEEUT00000010354
Sequence length 362
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7581:75879:103610:-1 gene:ENSEEUG00000010355 transcript:ENSEEUT00000010354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSL
SWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPIISFKFGQKXXXXXXXXXXXX
XXXXXXXXXXXXXXXYDDFLKSTQKSPATAPKPMPPRPPLPNQQFGVSLQHLQEKNPEQE
PIPLVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVI
LKTFLRELPEPLLTFDLYPHVVGFLNIEESQRVEVTLQALQALPEENYQVLRFLTAFLVQ
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHQEELFPCPDSK
GL
Download sequence
Identical sequences ENSEEUP00000009440 ENSEEUP00000009440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]