SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009557 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009557
Domain Number 1 Region: 82-165
Classification Level Classification E-value
Superfamily HMG-box 1.96e-25
Family HMG-box 0.00012
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily HMG-box 9.03e-20
Family HMG-box 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009557   Gene: ENSEEUG00000010501   Transcript: ENSEEUT00000010484
Sequence length 186
Comment pep:novel scaffold:HEDGEHOG:scaffold_291864:68:636:-1 gene:ENSEEUG00000010501 transcript:ENSEEUT00000010484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKEAQLLRPKVNVSSYIHFLLNYRNKFKEQQPNTFLGFKEFSRKCSEKWKSISKHEKAK
YEALAKLDKARYQEEMMNYPGRRRRRRRKRDPLAPRRPPSSFLLFCQEHYPHLKRENPNW
SVVQVAKATGKMWASTSSNEKQPYEQRAAFLRAKYQEDLKEYHKQCKARKGSKGLAKKYR
GKVGSR
Download sequence
Identical sequences ENSEEUP00000009557 ENSEEUP00000009557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]