SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009606 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009606
Domain Number 1 Region: 468-600
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.1e-39
Family BCR-homology GTPase activation domain (BH-domain) 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009606   Gene: ENSEEUG00000010500   Transcript: ENSEEUT00000010537
Sequence length 642
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_6594:2517:52540:1 gene:ENSEEUG00000010500 transcript:ENSEEUT00000010537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQLPPARQMNLGFGDESPEPEASGRGERLGKKVAPLATTEDSLASIPFIDEPTSPSIDLQ
AKHVPASAVVSSAMNSAPVLGTSPSSPTFTFALSRHYSQDCSSIKASRRSSYLLAITTER
SKSCDDGLNTFRDEGRALRRLPNRVPSLRMLRSFFTDGSLDSWGTSEDADAPSKRHSTSD
LSDATFSDIRREGWLHYKQVLTKKGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXDPGYANQALISKKLNDYRKVSHSSGPKADSSPKGSRGLGGLKSEFLKQ
SAVRGLWTQDQSAGSKDDNAAAHRTPWGINIIKKNKKAPPRAFGVRLEECQPATENQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRWQDLNVISSL
LKSFFRKLPEPLFTDDKYNDFIEANRIEDSRERMKTLRKLIRDLPGHYYETLKFLVGHLK
TIADHSEKNKMEPRNLALVFGPTLVRTSEDNMADMVTHMPDRYKIVETLIQHSDWFFSDK
EDKGERTPVDDKEPQSVPNIEYLLPNIGRTVPPGDQGSGESL
Download sequence
Identical sequences ENSEEUP00000009606 ENSEEUP00000009606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]