SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009625 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000009625
Domain Number - Region: 51-70
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0192
Family PHD domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009625   Gene: ENSEEUG00000010478   Transcript: ENSEEUT00000010560
Sequence length 1061
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_7597:37732:126012:1 gene:ENSEEUG00000010478 transcript:ENSEEUT00000010560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSSDRPVYEDEVSHIMKEMIGCVCSDQRGXXXXXXXXXXXXXXXXXXXXXCYGIVQVPT
GPWFCRKCESQERAARVXXXXXXXXXXXXXXXXXXXWAHVVCALYIPEVQFANVSTMEPI
VLQSVPHDRYNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQFAGLLCEEEGN
GADNVQYCGYCKYHFSKLKKSKRGSNRSYDQSLSDSSSHSQDKHHEKEKKKYKEKDKHKK
HKPDSHALVPSLTVTTEKTYTSTSSNSISGSLKRLEDTAARFTNANFQEVSTHTTSGKDV
PEARGSESKGKKSSAHNSGQRGRKPAGRNPGTTVSASSPFQQGSFSGTPSSVKSSSGSSV
QSPQDFLSFTDSDLRNDSYTHSQQSSSTKDVHKGESGSQDAGVNSFGSLIGLPSTSAVIS
QPKNFENSPGDLGNSSLPIAGYKRTQTSGIEEEAVKEKKRKVNKQSKHGPGRPKGNKNQE
NVSHLSVSSASPTSSVASAAGSVTSSSLQKSPTLLRNGSLQSLSVGSSPVGSEISMQYRH
DGACPTTTFSELLNAIHNGIYNSNDVAVSFPSVVSGSGSSTPVSSSHLPQQSSGHLQQVG
ALSPSAASSATPAATTQANTLPGSSLSQAPSHIYGNRLNSTSSMAAALIAQSENNQTDQD
LGDNSRSLVGRGSSPRGNLSPRSPVSSLQIRYDQPGNSSLENLPPVAASIEQLLERQWSE
GQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTIT
ANPSPSHQMHAFPAQTVPTTDSLNSSKSPHLGNSFLPDNSLPVLNQDSTSSGQSTSSSSA
LSTPPPAGQSPAQQGPGLSGVQQVNGVTVGTLASGMQTVTSTIPAMPGVGGIIGALPGSQ
LAINGIVGALNGVIQTPVTISQNPTPLTHTTVPPNATHPMPATLTNSASGLGLLSDQQRQ
IFLHQQQFQQLLNSQQLTPEQHQALLYQLMQQHHQQHPPELQQLQIPGPTPIPINNLLAG
PQAPPLHPATTNPFLTIHGDSAGQKVTRLSDKTGPVAQEKS
Download sequence
Identical sequences ENSEEUP00000009625 ENSEEUP00000009625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]