SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009733 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009733
Domain Number 1 Region: 742-872
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-30
Family Synaptotagmin-like (S variant) 0.0000021
Further Details:      
 
Domain Number 2 Region: 1545-1664
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-23
Family Synaptotagmin-like (S variant) 0.0069
Further Details:      
 
Domain Number 3 Region: 574-653
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000692
Family PDZ domain 0.0000823
Further Details:      
 
Weak hits

Sequence:  ENSEEUP00000009733
Domain Number - Region: 157-189
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000233
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009733   Gene: ENSEEUG00000010560   Transcript: ENSEEUT00000010683
Sequence length 1693
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_910:139:254899:1 gene:ENSEEUG00000010560 transcript:ENSEEUT00000010683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAVGPRGPRPPTVPPPMQEMPDLSHLTEEERNIILAVMDRQKEEEEKEEAMLKCVVRD
MVKPAACKTPRNAENQPHQPSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVMWVCNLCRKQQEILTKSGAWFF
GSGPQQPSQDGTLSDTATGAGSEVPREKKARLQERSRSQTPLSTAAALVQDTTPPRGTKA
DKSKGAEASQQAMGPDQKQASSRSRSEPPREXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXDLDYYWLDPATWHSRETSPISSHPVTWQPSKEGDRLIGR
VILNKRTTMPKESGALLGLKVVGGKMTELGRLGAFITKVKKGSLADVVGHLRAXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSSFESQKM
ERPSISVISPTSPGALKDAPQVLPGQLSVKLWYDKVGHQLIVNVLQATDLPSRIDGRPRN
PYVKMYFLPDRSDKSKRRTKTVKKVLEPKWNQTFVYSHVHRRDFRERMLEITVWDQPRVQ
EEESEFLGEILIELETALLDDEPHWYKLQTHDESSLPLPQPSPFMPRRHIHGESSSKKLQ
RSQRISDSDISDYEVDDGIGVVPPVGYRSSARESKSTTLTVPEQQRTTHHRSRSVSPHRG
DDQGRPRSRLPNVPLQRSLDEIHPTRRSRSPTRHHDASRSPSDYRSRDVDSQYLSEQDSE
LLMLPRAKRGRSAECLHTTRHVVRHYKTLPPKMPSLENSSHWDIYSSILPAHSKTNSVTR
QHIPLHHDYFNSRMLRFTDDILVSELQPSLDRARSASTNCLRPDTSLHSPERERGRWSPS
LDRRRPPSPRIQIQHASPENDRHSRKSERSSIQQQTRKGTASDAERVHPPCLSRRGYAAP
RTTDQPRLFKETYLAGTRPGETSIIRTMEFMXXXXXXXXXXXXXXXXXMHQGSPTQSPSA
DAAFSNRRGRQLPQVPVRSGSIEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEQY
SKYNIHKDQYRSCDNVSAKSSDSDVSDVSAISRTSSASRLSSTSFMSEQSERPRGRISSF
TPKMQGRRMGTSGRAIMKSTSVSGEMYALEHNDGSQSDTAVGTVGAGGKKRRSSLSARVV
AIVSRRSRSTSQLSQTESGHKKLKSTIQRSTETGMAAEMRKMVRQPSRESTDGSINSYSS
EGNLIFPGVRLGADSQFSDFLDGLGPAQLVGRQTLATPAMGDIQIGMEDKKGQLEVEVIR
ARSLTQKPGSKSTPAPYVKVYLLENGACIAKKKTRIARKTLDPLYQQSLLFDESPQGKVL
QVIVWGDYGRMDHKCFMGVAQILLEELDLSSMVIGWYKLFPPSSLVDPTLTPLTRRASQS
SLESSTGPPCIRS
Download sequence
Identical sequences ENSEEUP00000009733 ENSEEUP00000009733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]