SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009819 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009819
Domain Number 1 Region: 893-932
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000532
Family PHD domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009819   Gene: ENSEEUG00000010747   Transcript: ENSEEUT00000010780
Sequence length 1423
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_1080:21504:132186:-1 gene:ENSEEUG00000010747 transcript:ENSEEUT00000010780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAAAMAAPGSPGACPNFAVVCSFLERYGPLLDLPELPFPELERVLQAPPPDVGDG
EVPKELVELHLKLMRKIGKSVTADRWEKYLIKICQDFNSTWAWEMEKKGYLEMSVECKLA
LLKYLCECQFDDNLKFKNIINEEDADTMRLQPIGRDKDGLMYWYQLDQDHNVRMYIEEQD
DQDGSSWKCIVRNRNELAETLTLLKAQIDPVLLKNCSQQDISSRESPNIEDEETKKEEET
PKQEEQKENEKIEGEEPPIDSENHSSLNMLEETTVKIEKDDVRELVKLPVIVKLEKPFPE
IEEKNIIKEESDSFKENVKPMKVECRADTKDTKSSLEKLEPERQEFGSNIKSSQEIVEKP
TDETEKLKNDQQAKIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIIEGDGA
ESFNFVVTSLKIDDVEKEVVPKGNSLSLLETQSQKEQLEQVGLPETETSLETSAVAKDLS
LKTVLSTTESCTVKVEEKFPQCIKDKRPPVIECLEKLDKSKKTFDKDTQRLSPIPEEVSK
STLELKRPYSPGVRKISSPPIMTDHCEKQGSNKEVVGCQNTGSVEEHSQEKGDSEIQKQQ
DSESKKMEMDNLDSAQTSGREGPSEAKGSVQKSKFKYKLISEEETTVSENTEITSERQKE
GIKLTIRISSRKKKPDSPAKIVEAEAKQKTEKEEEKVNVGRTLRRSPRISRPTAKVAEIR
DQKADKKKGDGDDEVDEETAALQKTDKKENLKKMEKDINSKINKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILLCDSC
DSGYHTACLRPPLMIIPDGEWFCPPCQHKLLCEKLEEQLQDLDVALKKKERAERRKERLV
YVGISIENIIPPQEPDLSEDHEEKKKDSKKSKANLLERRSTRTRKCISYXXXXXXXXXXX
XXXXXXXXXXXXXIGRGKDISTITGHRGKDISTILDEERKENKRPQRAAAAARRKKRRRL
NDLDSDSNLDEEESEDEFKISDGSQDEFVVSDENPDESDEDPPSNDESDTDFCSRRLRRH
TSRPMRQSRRLRRKTSKKKYSDDDEEEESEENSRDSESDFSDDFSDGLVETRRRGSRRNQ
KRQINYKEDSESDGSQKLRRGKEIRRIHKRRLSSSESEESYMSKNSEEDKLAKESKRLVR
KRRRSSDEYSEEEEEGKPSRKRLHRIETDEESCDNAHGDVDQPVHDRQPRELLSEQESTK
KPYRIESEEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKPQTPKDNN
TTSASLAPNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL
Download sequence
Identical sequences ENSEEUP00000009819 ENSEEUP00000009819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]