SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009880 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSEEUP00000009880
Domain Number 1 Region: 220-559
Classification Level Classification E-value
Superfamily DNase I-like 3.66e-76
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000225
Further Details:      
 
Domain Number 2 Region: 665-678,716-877
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.18e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009880   Gene: ENSEEUG00000010786   Transcript: ENSEEUT00000010842
Sequence length 886
Comment pep:novel genescaffold:HEDGEHOG:GeneScaffold_3007:3921:75139:1 gene:ENSEEUG00000010786 transcript:ENSEEUT00000010842 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAPYPVGAQPLARPHTIEGMEMKGPIREPCTLTLAQRNGQYELIIQLHEKEQHVQDIIP
INSHFRCVQEAEETLLIDIASNSGCKRVQGLIRERRFEIPDEEHCKFLSEVLAAQDAQSQ
LLVPEQKDSSNWYQKLDTKEKPSVFSGLLGFEDNFSSINLDKRINSQNQPTGIHREPPPP
PPSTNRMLPREKETSNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQSF
RFFVGTWNVNGQSPDSGLEPWLDCDPNPPDIYCIGFQELDLSTEAFFYFESVKEQEWSMA
VERGLHSKVKYKKVQLVRLVGMMLLIFARKDQWRYIRDVATETVGTGIMGKMGNKGGVAV
RFVFHNTTFCIVNSHLAAHVEDFERRNQDYKDICARMSFVVPNQTLPQLNLMKHDVVIWL
GDLNYRLCMPDANEVKSLISKNDLQRLLKFDQXXXXRTQKKAFVDFMEGDIKFTPTYKYD
SKTDRWDSSGKCRVPAWCDRILWRGININQLHYRSHMELKTSDHKPVSALFNIGVKVVDE
RRYRKVFEDIVRIMDRMENDFLPSLELSRREFVFENVKFRQLQKEKFQISNNGQVPCHFS
FIPKLNDTQYCKPWLRAEPFEGYLEPNETVDISLDVYVSKDSVTILNSXXXTSKDTLTIS
NYLSFGTSLEALCRMKRPIREVPVTKLIDLVRSSILTRGKSLLQMVPLDEGASERPLQVP
KEIWLLVDHLFKNACHQEDLFQTPGMQEELQQIIDCLDTSIPETIPGSNHSVAEALLIFL
EALPEPVICYELYQRCLDSAHDPRVCRQVISQLPRCHRNVFRYLMAFLRELLKFSEYNNV
SANMIATLFTSLLLRPPPNFMAKQTPSDRQRAIQFLLGFLLGSDED
Download sequence
Identical sequences ENSEEUP00000009880 ENSEEUP00000009880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]