SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSEEUP00000009962 from Erinaceus europaeus 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSEEUP00000009962
Domain Number - Region: 38-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000161
Family I set domains 0.051
Further Details:      
 
Domain Number - Region: 140-171
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00301
Family TSP-1 type 1 repeat 0.0083
Further Details:      
 
Domain Number - Region: 205-284
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0065
Family C1 set domains (antibody constant domain-like) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSEEUP00000009962   Gene: ENSEEUG00000010928   Transcript: ENSEEUT00000010930
Sequence length 359
Comment pep:novel scaffold:HEDGEHOG:scaffold_278165:8397:12011:1 gene:ENSEEUG00000010928 transcript:ENSEEUT00000010930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWTALWLLATLVVPALGTYESIDCPLGLQCQRALLSHNDIVLRCNLSQEAQWFHTPCIMG
GFNITTFPNMEQLPEGHLLIRNPEPSQSGFYLCTDRSSGFTATYEIDFQDAGTLHVTHRN
LSLAPLREEVLSLGSGTLVFTRWEPWQDCSRCGRVGERRRLGFCFIREAEQQAVPCGLYL
GALWSRRLRPEMQVDACYTPCRPGAQAPLVVFSSFKFDETTESVWLTCPLGSIYRPIIWE
ADGVPLTWQGQLSGQDLSTMLDPSNGGRRLQVFQPAIYKCFVQQELVARFNPKADMEKLE
SPWKGGPSPAAAPQGKADLVLQGLKLMLLVGLALGLLGGLFKFLRPARGKWGDQVLLVK
Download sequence
Identical sequences ENSEEUP00000009962 ENSEEUP00000009962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]